close

SimulationCraft 406-19

for World of Warcraft 4.1.0 PTR (build level 13812)

Table of Contents

Raid Summary

DPS Chart DPS Chart Gear Chart Gear Chart Timeline Distribution Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Death_Knight_Unholy_1h_T11_372 : 23051dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
23050.9 12.63 / 0.05% 3427.6 6.7 6.8 runic_power 19.43% 50.5
Origin http://chardev.org/?profile=34574
Talents http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
Glyphs
  • horn_of_winter
  • raise_dead
  • death_and_decay
  • death_coil

Charts

http://9.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:41270|14417|9972|9482|6399|6395|5991|5932|2360|2106|1312|831&chds=0,82541&chco=9482C9,9482C9,336600,C79C6E,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++41270++death_and_decay,9482C9,0,0,15|t++14417++death_coil,9482C9,1,0,15|t++9972++gargoyle_strike,336600,2,0,15|t++9482++festering_strike,C79C6E,3,0,15|t++6399++scourge_strike,C79C6E,4,0,15|t++6395++sweeping_claws,C79C6E,5,0,15|t++5991++plague_strike,C79C6E,6,0,15|t++5932++icy_touch,2459FF,7,0,15|t++2360++melee,C79C6E,8,0,15|t++2106++melee_main_hand,C79C6E,9,0,15|t++1312++melee_off_hand,C79C6E,10,0,15|t++831++melee,C79C6E,11,0,15&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:16,10,10,9,9,8,6,6,6,5,5,4,4,2,0,0,0,0&chds=0,100&chco=9482C9,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,9482C9,C79C6E,336600,C79C6E,2459FF,C79C6E,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|melee|sweeping_claws|scourge_strike|melee_main_hand|scourge_strike_shadow|blood_plague|death_and_decay|melee_off_hand|gargoyle_strike|claw|frost_fever|festering_strike|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_1h_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:RdrMFQdnvxwz5743554453457776664320zxwwwwwwusqponmlkjjihgffeddccbaZZZZZZYYYXXXXWWWWWVVVVVVUUUVVVVVVVVUUUUVVVVUUUVVUVVVVVVVWWVVVVVVWWWWVVVVVVVVVVVVVVVUUUUUUUUVVUUUUVVVVVVVVVVVVVVWVVVWWXWWVVVVVVVVVVVVWWWWWWWWWXXXXXXWWWVVVUUUUUUUUVUUUVVVVVVVVVVVVWWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVXYaccddcccccbbbaaaZZZZYYYYYYYYZZZZaaaabccdefggghgggffeddbbbaaaaaZZZZYYYYYYYYYXYXXXYYYYYXXWWWWWVVVVVVVVVVVVUVVVUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=76&chtt=Death_Knight_Unholy_1h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uvxyz001222456877765421zywvusrppnmlkjihggfffeeddccbbaaZZZYYYYYYYYYZZZZZZZaZaZZZZZZZYYYYXXXXXXXXXXXXXXXYYYYYZZZZaaaaaabbbbbbbcbcccccccccccccbbbbaaZZZYYXXWWWWWWWWWWWWWXXXXXXYYYYZZZZaaaabbbcccdddeefffgggggggggggffffeeeddddccccccccccccccccccccbbbbbaaaaZZZZZZYYYYYYYYYYYYYYYYYYYXYXXXXXXXXXXXXYXXYYYYYYYYYYYZYZYZYZZZZZZZZZZaaaaaabbbbcccccddddddcdcdcccccccccccccccccccddddddeeeeefffffgggggggggggggggfffeeeddcccbbaaaaZZZZZZZZZZZZZZaaaaaaabbbbbbbbbbbbbabbaabaab&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=23051|max=47934&chxp=1,1,48,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,1,1,5,7,17,24,49,59,102,118,167,248,261,341,370,469,492,589,577,573,621,600,566,555,512,453,409,358,308,261,197,194,149,101,75,60,43,20,12,10,10,4,3,3,0,1,1&chds=0,621&chbh=5&chxt=x&chxl=0:|min=20742|avg=23051|max=25620&chxp=0,1,47,100&chtt=Death_Knight_Unholy_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_1h_T11_372 23051
blood_plague 1413 6.1% 7.2 67.39sec 89110 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3636 7599 15.6% 0.0% 99.6%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.17 7.17 150.18 150.18 0.0000 3.0000 638804
Direct Results Count Pct Average Min Max Total Damage
hit 7.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.41% 3635.74 2900 5300 460871
crit 23.4 15.59% 7599.43 6061 11077 177932

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 3.0 78.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.05 3.05 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.0 50.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.96 8.96 0.00 0.00 1.0162 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.0 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 1346 5.8% 14.5 32.22sec 41975 41270 0 0 0 15.7% 0.0% 0.0% 0.0% 242 2145 4482 15.7% 0.0% 50.4%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.50 14.50 242.34 242.34 1.0171 0.9402 608448
Direct Results Count Pct Average Min Max Total Damage
hit 12.2 84.33% 0.00 0 0 0
crit 2.3 15.67% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 204.4 84.33% 2144.53 1748 3185 438278
crit 38.0 15.67% 4481.99 3653 6657 170170

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:16
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3659 15.9% 113.9 3.92sec 14524 14417 11853 24773 34578 20.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.91 113.91 0.00 0.00 1.0074 0.0000 1654454
Direct Results Count Pct Average Min Max Total Damage
hit 90.4 79.32% 11852.63 9830 16544 1071003
crit 23.6 20.68% 24773.13 20546 34578 583452

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 302.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 917 4.0% 43.1 10.51sec 9615 9482 8648 17808 23285 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
43.10 43.10 0.00 0.00 1.0141 0.0000 414411
Direct Results Count Pct Average Min Max Total Damage
hit 38.5 89.43% 8647.53 7462 11303 333312
crit 4.6 10.57% 17807.55 15372 23285 81099

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 1003 4.4% 8.7 54.26sec 52302 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5390 15.6% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.67 8.67 150.24 150.24 0.0000 3.0000 453528
Direct Results Count Pct Average Min Max Total Damage
hit 8.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 126.8 84.39% 2580.02 2055 3767 327101
crit 23.5 15.61% 5390.46 4295 7874 126428

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 36 0.2% 2.7 110.04sec 6020 5932 5142 10764 15113 15.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.74 2.74 0.00 0.00 1.0149 0.0000 16482
Direct Results Count Pct Average Min Max Total Damage
hit 2.3 84.37% 5141.58 4435 7526 11876
crit 0.4 15.63% 10763.69 9269 15113 4606

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2103 9.1% 263.1 1.72sec 3613 2106 4045 8328 11234 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
263.11 263.11 0.00 0.00 1.7157 0.0000 950738
Direct Results Count Pct Average Min Max Total Damage
hit 130.2 49.49% 4045.30 3414 5454 526758
crit 27.9 10.60% 8328.04 7033 11234 232292
glance 63.2 24.01% 3034.07 2560 4090 191687
miss 41.8 15.90% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1310 5.7% 262.3 1.72sec 2258 1312 2527 5203 7021 10.6% 15.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
262.32 262.32 0.00 0.00 1.7209 0.0000 592305
Direct Results Count Pct Average Min Max Total Damage
hit 129.8 49.49% 2526.90 2134 3408 328079
crit 27.9 10.64% 5202.75 4395 7021 145188
glance 62.8 23.95% 1894.52 1600 2556 119037
miss 41.7 15.91% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.9 82.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.93 5.93 0.00 0.00 1.0162 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 17 0.1% 1.2 136.01sec 6114 5991 5486 11307 15226 10.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.24 1.24 0.00 0.00 1.0205 0.0000 7551
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 89.21% 5486.28 4920 7391 6045
crit 0.1 10.79% 11306.93 10136 15226 1506

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 2152 9.3% 150.0 2.98sec 6486 6399 5831 12013 15662 10.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.04 150.04 0.00 0.00 1.0136 0.0000 973137
Direct Results Count Pct Average Min Max Total Damage
hit 134.2 89.41% 5830.83 5042 7603 782208
crit 15.9 10.59% 12012.79 10387 15662 190929

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 1760 7.6% 150.0 2.98sec 5303 0 5303 0 12806 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
150.04 150.04 0.00 0.00 0.0000 0.0000 795660
Direct Results Count Pct Average Min Max Total Damage
hit 150.0 100.00% 5302.84 3028 12806 795660

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:5393.26
  • base_dd_max:5393.26
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.3 219.69sec 0 0 0 0 0 15.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.30 2.30 0.00 0.00 1.0051 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 1.9 84.64% 0.00 0 0 0
crit 0.4 15.36% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 359 1.6% 113.9 3.92sec 1426 0 0 0 0 0.0% 0.0% 0.0% 0.0% 407 399 0 0.0% 0.0% 90.0%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.91 113.91 406.96 406.96 0.0000 1.0000 162448
Direct Results Count Pct Average Min Max Total Damage
hit 113.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 407.0 100.00% 399.17 100 1371 162448

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:575.83
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1412
claw 605 42.8% 13.0 2.86sec 1628 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21170
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.81% 1491.43 1491 1491 17607
crit 1.2 9.19% 2982.86 2983 2983 3563

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 807 57.2% 23.0 1.48sec 1229 831 1189 2379 2379 9.3% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 1.4776 0.0000 28259
Direct Results Count Pct Average Min Max Total Damage
hit 15.4 66.77% 1189.27 1189 1189 18264
crit 2.1 9.29% 2378.55 2379 2379 5085
glance 5.5 23.94% 891.95 892 892 4910

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1751
gargoyle_strike 1751 100.0% 48.5 6.45sec 11231 9972 11231 0 16064 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.49 48.49 0.00 0.00 1.1263 0.0000 544603
Direct Results Count Pct Average Min Max Total Damage
hit 48.5 100.00% 11230.97 8668 16064 544603

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 5661
claw 1060 18.7% 117.3 3.81sec 4087 0 3743 7488 11262 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
117.29 117.29 0.00 0.00 0.0000 0.0000 479357
Direct Results Count Pct Average Min Max Total Damage
hit 106.5 90.81% 3742.84 2746 5631 398678
crit 10.8 9.19% 7488.32 5492 11262 80679

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2358 41.6% 340.9 1.33sec 3127 2360 3030 6060 9221 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
340.91 340.91 0.00 0.00 1.3248 0.0000 1066035
Direct Results Count Pct Average Min Max Total Damage
hit 227.7 66.80% 3030.02 1861 4611 690006
crit 31.4 9.20% 6059.60 3722 9221 190096
glance 81.8 24.00% 2272.66 1396 3458 185933

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2244 39.6% 153.0 2.79sec 6631 6395 6071 12145 16633 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
152.98 152.98 0.00 0.00 1.0370 0.0000 1014439
Direct Results Count Pct Average Min Max Total Damage
hit 138.9 90.77% 6070.62 5273 8316 842996
crit 14.1 9.23% 12144.96 10545 16633 171443

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_1h_T11_372
death_coil runic_power 95.5% 570.0 25
summon_gargoyle runic_power 4.5% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 43.4% 102.2 40
sweeping_claws energy 56.6% 165.8 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1808.8 180.3 0.1 0.3%
horn_of_winter runic_power 17.9 179.0 10.0 0.0%
rune_abilities runic_power 223.6 2709.7 12.1 0.3%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 430.7 3.1 0.0%
pet - ghoul energy
energy_regen energy 1808.8 10732.0 5.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.4sec 120.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.3 0.0 57.5sec 57.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.0 0.0 50.8sec 50.8sec 57% 57%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.4 45.7 49.2sec 8.1sec 84% 83%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 43.8 0.0 10.1sec 10.1sec 34% 34%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.3 38.4 50.4sec 9.3sec 36% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 28.6 0.2 15.5sec 15.4sec 4% 4%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 79.4 285.7sec 5.5sec 98% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.1 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.3 48.5 219.9sec 6.2sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 69.84%
σ of the average dps 6.3167
2 * σ / μ 0.0548%
95% Confidence Intervall ( μ ± 2σ ) ( 23038.25 - 23063.51 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 23031.93 - 23069.83 )
Sample Data
σ 631.6719
Minimum 20741.76
Maximum 25619.68
Spread ( max - min ) 4877.92
Range ( max - min ) / 2 2438.96
Range% 10.58
10th Percentile 22282.50
90th Percentile 23915.40
( 90th Percentile - 10th Percentile ) 1632.90
Approx. Iterations needed for
1% dps error 30
0.1% dps error 3003
0.1 scale factor error with delta=300 3546
0.05 scale factor error with delta=300 14187
0.01 scale factor error with delta=300 354675
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILEPQPPPR5PPPRPQNPQRPPPPMDPPMPQMOQPMPPNPMPNPQMPRRTKLPPPMRUNPPPRROQRDQRRPPPRUPPPRRPQRPQROPPRUCAPPRPQRPQRUPPPRDOPR5RPQRRUPQRPPPRNPPNORUCBRPQRPQRDPPRPSPU9RPPOQGRPQRPUPPRPPPNRPQROQRUDPPRAPSPRPPNPQRUPRQOR5PPPRPPURPQRPQPPPRPOPRURBCRDRQPRQPRPPPSPRUPORPQRPQNRPPPRPPPURPQRDQROPTKLPMPPPMPPPB9AMRUPQRR5PQNPROPPRSPPRPRUDQRPQPRPPPRUROPCRBPQRURPPQRRPNDRORPPRPQRUPQNRPPPPNPPRRPQRUPRQNRORPPP7RADNP5URPQNPQRRPPPRORSPPUPRPQRPQRPPPRUPNPPRDQRR9

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7000 5632 4914
Agility 721 138 20
Stamina 7637 6015 5825
Intellect 55 53 20
Spirit 85 85 20
Health 149873 127235 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.48% 18.48% 971
Spell Crit 12.45% 7.45% 1336
Spell Haste 12.35% 7.00% 896
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16794 12394 190
Melee Hit 11.08% 11.08% 971
Melee Crit 15.41% 8.02% 1336
Melee Haste 23.05% 7.00% 896
Expertise 27.04 27.04 812
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.08% 16.08% 1448

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 2
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 1
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 0
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_1h_T11_372
origin="http://chardev.org/?profile=34574"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203200000000000000000030000000000000000003310321230031021231
glyphs=horn_of_winter/raise_dead/death_and_decay/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_exp,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_hit,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=crit_mastery,gems=40str_67str_10hit
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_hit,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_exp,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=cloudburst_ring_of_the_faultline,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143haste_143mastery,reforge=haste_exp,suffix=118
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_mastery,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_hit,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,reforge=haste_exp,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
# Gear Summary # gear_strength=4914
# gear_agility=20
# gear_stamina=5825
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=812
# gear_hit_rating=971
# gear_crit_rating=1336
# gear_haste_rating=896
# gear_mastery_rating=1448
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_2h_T11_372 : 26538dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26537.7 13.53 / 0.05% 3677.8 7.2 7.3 runic_power 11.08% 55.5
Origin http://chardev.org/?profile=87453
Talents http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
Glyphs
  • blood_boil
  • pestilence
  • antimagic_shell
  • horn_of_winter
  • blood_tap
  • raise_ally
  • scourge_strike
  • raise_dead
  • death_coil

Charts

http://6.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:27764|13586|13347|10417|8977|8553|6432|5810|2798|2610|914&chds=0,55528&chco=9482C9,9482C9,C79C6E,336600,C79C6E,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E&chm=t++27764++death_and_decay,9482C9,0,0,15|t++13586++death_coil,9482C9,1,0,15|t++13347++festering_strike,C79C6E,2,0,15|t++10417++gargoyle_strike,336600,3,0,15|t++8977++scourge_strike,C79C6E,4,0,15|t++8553++plague_strike,C79C6E,5,0,15|t++6432++sweeping_claws,C79C6E,6,0,15|t++5810++icy_touch,2459FF,7,0,15|t++2798++melee_main_hand,C79C6E,8,0,15|t++2610++melee,C79C6E,9,0,15|t++914++melee,C79C6E,10,0,15&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x370&cht=p&chf=bg,s,333333&chd=t:15,13,13,11,10,9,6,5,5,4,4,3,1,0,0,0,0&chds=0,100&chco=9482C9,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E,9482C9,C79C6E,2459FF,9482C9,9482C9,C79C6E,C79C6E,2459FF,C79C6E&chl=death_coil|scourge_strike_shadow|scourge_strike|melee_main_hand|melee|sweeping_claws|gargoyle_strike|festering_strike|blood_plague|claw|frost_fever|death_and_decay|unholy_blight|melee|claw|icy_touch|plague_strike&chtt=Death_Knight_Unholy_2h_T11_372+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:QcpMENWfmnqv23224324544578776765432110000zyxwutttsrrrrrqqppoonnnmllkjjiihhgggffeeddcccccbbbaaaaaZZZZZYYYYZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXYYXXXXXXXXXXXXXXXXXXXXXXXXYYYYYZZWWWWWWWWXXYYZZaabbccddeeeefffedccbaaaZZZYYYYYYXXXXXXXXXXXXYXXXYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXYYYXXXXXXXXXYXXXXYYXXYXXXYYYYYYYZZZYYYZZZZYYYZZYYYZZZZZZZaabbcdefghhijkllllllllkkjiihhhgggggggggghhghhhhhhiihhgfeeddcbbbbaaaaaaZZZZZZZYYZYYZYYYYYYYYYYYYYYYYYYYYYYYYYYX&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=80&chtt=Death_Knight_Unholy_2h_T11_372+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:vwxyzz001113567778765320zyxwvtsrqpnnlkjiihhhhggffeeddcccbcbbbbbccccccccccdddddddddccbbbbbbaaaaaaZZZZZZZZZZZaaaaabbbbbccccdddeeeffffffffffffeeeddcccbbaaaZaZZZZZZZZZZZZaZaaaaababbbcbccdddeeffgghhhiijjjkkkkkkjjjjjiihhhhgggfffffffffffeeeeeeedddddccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbabaaaaaaaaaaaaaaaaaaaaaaaaaZaZZZZZZaaaaaaabbbbbcccccdddddddddddddddddddddddddeeeefffggghhhiijjjkkllmmnnnnooooonnnnmmllkkjihhgffeedddccccccccccbccccccccccccccccbbbbbbcbbbbcbbbbcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26538|max=50793&chxp=1,1,52,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,4,3,4,11,15,23,35,49,76,84,112,127,172,202,267,300,350,358,429,459,496,536,527,564,537,523,479,495,435,397,344,312,252,247,159,137,121,91,73,59,47,34,17,7,13,6,4,5,1&chds=0,564&chbh=5&chxt=x&chxl=0:|min=24285|avg=26538|max=28915&chxp=0,1,49,100&chtt=Death_Knight_Unholy_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Unholy_2h_T11_372 26538
blood_plague 1332 5.0% 6.3 77.77sec 95900 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3519 7351 12.7% 0.0% 99.7%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.28 6.28 150.27 150.27 0.0000 3.0000 602058
Direct Results Count Pct Average Min Max Total Damage
hit 6.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.27% 3518.51 2817 5142 461415
crit 19.1 12.73% 7351.19 5888 10746 140643

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 2.1 107.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.11 2.11 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.4 48.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.43 9.43 0.00 0.00 1.0121 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.4 100.00% 0.00 0 0 0

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_and_decay 912 3.4% 14.7 31.85sec 28116 27764 0 0 0 12.8% 0.0% 0.0% 0.0% 174 2080 4347 12.8% 0.0% 35.2%

Stats details: death_and_decay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.66 14.66 173.97 173.97 1.0127 0.9157 412165
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 87.22% 0.00 0 0 0
crit 1.9 12.78% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.8 87.25% 2080.14 1698 3090 315747
crit 22.2 12.75% 4346.74 3549 6458 96418

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:unknown
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every sec.
  • description:Corrupts the ground targeted by the Death Knight, causing ${$m1+($AP*0.064)} Shadow damage every sec that targets remain in the area for $d. This ability produces a high amount of threat.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:46.13
  • num_ticks:11
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 3848 14.5% 127.2 3.51sec 13677 13586 11460 23951 33535 17.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.19 127.19 0.00 0.00 1.0067 0.0000 1739531
Direct Results Count Pct Average Min Max Total Damage
hit 104.6 82.25% 11459.84 9543 16045 1198810
crit 22.6 17.75% 23950.59 19946 33535 540721

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:34.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $ Shadow damage to an enemy target or healing $ damage on a friendly Undead target$?s58677[. Refunds $58677s1 runic power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.230000
  • base_dd_min:985.70
  • base_dd_max:985.70
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 306.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.97 1.97 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 1452 5.5% 48.6 9.32sec 13500 13347 12791 26350 33998 7.5% 2.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.61 48.61 0.00 0.00 1.0115 0.0000 656240
Direct Results Count Pct Average Min Max Total Damage
hit 43.8 90.03% 12790.94 11218 16504 559739
crit 3.7 7.53% 26350.39 23109 33998 96500
dodge 1.2 2.44% 0.00 0 0 0

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:560.36
  • base_dd_max:560.36
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
frost_fever 977 3.7% 8.4 55.60sec 52660 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2580 5396 12.8% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.39 8.39 150.28 150.28 0.0000 3.0000 441758
Direct Results Count Pct Average Min Max Total Damage
hit 8.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 131.1 87.24% 2580.34 2064 3777 338297
crit 19.2 12.76% 5395.85 4313 7894 103461

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
icy_touch 35 0.1% 2.7 114.55sec 5874 5810 5170 10824 15152 12.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.72 2.72 0.00 0.00 1.0110 0.0000 15966
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 87.56% 5170.06 4338 7545 12305
crit 0.3 12.44% 10824.31 9302 15152 3661

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee and ranged attack speed reduced by $55095s2%.
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.2)} Frost damage and infects them with Frost Fever, a disease that deals periodic damage and reduces melee and ranged attack speed by $55095s2% for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.200000
  • base_dd_min:504.75
  • base_dd_max:548.46
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2792 10.5% 196.9 2.30sec 6411 2798 6431 13250 17541 7.7% 2.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
196.88 196.88 0.00 0.00 2.2914 0.0000 1262110
Direct Results Count Pct Average Min Max Total Damage
hit 129.6 65.84% 6430.55 5531 8515 833566
crit 15.2 7.70% 13249.78 11394 17541 200888
glance 47.2 23.97% 4823.39 4148 6386 227656
dodge 4.9 2.49% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 5.7 87.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.67 5.67 0.00 0.00 1.0136 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 12 0.0% 0.6 142.60sec 8696 8553 8234 16979 21701 7.6% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.62 0.62 0.00 0.00 1.0168 0.0000 5418
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 89.86% 8234.00 7458 10858 4609
crit 0.0 7.64% 16979.05 15364 21701 808
dodge 0.0 2.50% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 3456 13.0% 172.2 2.60sec 9071 8977 8599 17713 22804 7.5% 2.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
172.24 172.24 0.00 0.00 1.0104 0.0000 1562294
Direct Results Count Pct Average Min Max Total Damage
hit 155.1 90.04% 8598.98 7546 11070 1333574
crit 12.9 7.50% 17712.89 15545 22804 228720
dodge 4.2 2.46% 0.00 0 0 0

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:624.50
  • base_dd_max:624.50
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike_shadow 3554 13.4% 168.0 2.67sec 9564 0 9564 0 23453 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike_shadow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
168.00 168.00 0.00 0.00 0.0000 0.0000 1606728
Direct Results Count Pct Average Min Max Total Damage
hit 168.0 100.00% 9563.99 7760 23453 1606728

Action details: scourge_strike_shadow

Static Values
  • id:70890
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:9573.78
  • base_dd_max:9573.78
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
summon_gargoyle 0 0.0% 2.8 196.06sec 0 0 0 0 0 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 1.0055 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 2.4 86.85% 0.00 0 0 0
crit 0.4 13.15% 0.00 0 0 0

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:0.00
unholy_blight 377 1.4% 127.2 3.51sec 1342 0 0 0 0 0.0% 0.0% 0.0% 0.0% 410 416 0 0.0% 0.0% 90.8%

Stats details: unholy_blight

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
127.19 127.19 410.48 410.48 0.0000 1.0000 170643
Direct Results Count Pct Average Min Max Total Damage
hit 127.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 410.5 100.00% 415.72 98 1240 170643

Action details: unholy_blight

Static Values
  • id:49194
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Taking damage from a vile swarm of unholy insects. Diseases cannot be dispelled.
  • description:Causes the victims of your Death Coil to be surrounded by a vile swarm of unholy insects, taking $49194s1% of the damage done by the Death Coil over $50536d, and preventing any diseases on the victim from being dispelled.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:560.86
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - army_of_the_dead_ghoul_8 1562
claw 650 41.7% 14.0 2.62sec 1626 0 1491 2983 2983 9.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 0.0000 0.0000 22767
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 90.96% 1491.43 1491 1491 18993
crit 1.3 9.04% 2982.86 2983 2983 3774

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 911 58.3% 26.0 1.34sec 1227 914 1189 2379 2379 9.1% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.00 26.00 0.00 0.00 1.3426 0.0000 31891
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 66.92% 1189.27 1189 1189 20693
crit 2.4 9.12% 2378.55 2379 2379 5643
glance 6.2 23.95% 891.95 892 892 5555

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - gargoyle 1868
gargoyle_strike 1868 100.0% 62.5 5.92sec 11014 10417 11014 0 16107 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.52 62.52 0.00 0.00 1.0573 0.0000 688568
Direct Results Count Pct Average Min Max Total Damage
hit 62.5 100.00% 11013.89 8704 16107 688568

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.453000
  • base_dd_min:33.00
  • base_dd_max:38.00
pet - ghoul 6144
claw 1036 16.9% 115.4 3.86sec 4062 0 3719 7437 11289 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.39 115.39 0.00 0.00 0.0000 0.0000 468648
Direct Results Count Pct Average Min Max Total Damage
hit 104.8 90.79% 3719.22 2755 5645 389634
crit 10.6 9.21% 7437.25 5511 11289 79015

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 2607 42.4% 373.2 1.21sec 3159 2610 3061 6125 9243 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
373.16 373.16 0.00 0.00 1.2105 0.0000 1178968
Direct Results Count Pct Average Min Max Total Damage
hit 249.2 66.78% 3061.01 1867 4622 762748
crit 34.4 9.21% 6125.14 3734 9243 210567
glance 89.6 24.01% 2295.14 1400 3466 205653

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00
sweeping_claws 2500 40.7% 169.5 2.52sec 6670 6432 6109 12214 16673 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
169.46 169.46 0.00 0.00 1.0369 0.0000 1130255
Direct Results Count Pct Average Min Max Total Damage
hit 153.9 90.82% 6109.24 5291 8337 940207
crit 15.6 9.18% 12213.55 10581 16673 190048

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.50

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Unholy_2h_T11_372
death_coil runic_power 94.9% 561.7 24
summon_gargoyle runic_power 5.1% 0.0 60
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 40.5% 101.5 40
sweeping_claws energy 59.5% 166.7 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1808.8 179.6 0.1 0.7%
horn_of_winter runic_power 15.0 150.1 10.0 0.0%
rune_abilities runic_power 245.8 2967.0 12.1 0.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 474.0 3.4 0.0%
pet - ghoul energy
energy_regen energy 1808.8 11315.3 6.3 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 7.7 0.0 61.2sec 61.2sec 25% 25%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
dark_transformation 9.4 0.0 48.2sec 48.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_dark_transformation
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.5 0.0 111.1sec 111.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
rune_of_the_fallen_crusader 9.7 42.2 47.7sec 8.6sec 82% 82%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
runic_corruption 47.9 0.0 9.3sec 9.3sec 38% 38%

Database details

  • id:
  • cooldown name:buff_runic_corruption
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_infusion 9.8 40.4 48.1sec 8.8sec 34% 100%

Database details

  • id:
  • cooldown name:buff_shadow_infusion
  • tooltip:(null)
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
sudden_doom 36.2 0.3 12.3sec 12.2sec 6% 6%

Database details

  • id:
  • cooldown name:buff_sudden_doom
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.1 88.8 254.8sec 5.0sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_frenzy 3.0 0.0 180.4sec 180.4sec 19% 20%

Database details

  • id:
  • cooldown name:buff_unholy_frenzy
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
gargoyle-casting 2.8 62.5 196.2sec 5.7sec 18% 18%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.67%
σ of the average dps 6.7642
2 * σ / μ 0.0510%
95% Confidence Intervall ( μ ± 2σ ) ( 26524.21 - 26551.27 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26517.45 - 26558.03 )
Sample Data
σ 676.4231
Minimum 24285.16
Maximum 28914.83
Spread ( max - min ) 4629.67
Range ( max - min ) / 2 2314.83
Range% 8.72
10th Percentile 25708.46
90th Percentile 27441.91
( 90th Percentile - 10th Percentile ) 1733.45
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2598
0.1 scale factor error with delta=300 4067
0.05 scale factor error with delta=300 16268
0.01 scale factor error with delta=300 406709
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 raise_dead
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
A outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
B icy_touch,if=dot.frost_fever.remains<3
C plague_strike,if=dot.blood_plague.remains<3
D dark_transformation
E summon_gargoyle,time<=60
F summon_gargoyle,if=buff.bloodlust.react
G summon_gargoyle,if=buff.unholy_frenzy.react
H death_and_decay,if=death=4
I death_and_decay,if=unholy=2
J scourge_strike,if=death=4
K scourge_strike,if=unholy=2
L festering_strike,if=blood=2&frost=2
M death_coil,if=runic_power>90
N death_coil,if=buff.sudden_doom.react
O death_and_decay
P scourge_strike
Q festering_strike
R death_coil
S blood_tap,if=unholy=0&inactive_death=1
T empower_rune_weapon,if=unholy=0
U horn_of_winter

Sample Sequence

01236789AILENPPLPP5RPNPPPNPLMDMLKMJJPMPPOPMPRPQRPRQPPRPTKLPMPPPMMPLNPMPOPPMDPPMRQPRQPPNPPPMPPQMRUPRQPORPRPPSPPRBAPRURPQRQDRPPPPRROPPRRUQP5RQPRPPPRPPPPRQPRURQORRDPPRPSPPRPNUAQNPRQPR9RPPNORPPPNRPQRQPRUPRDPPRNPPQPRQORUPRPPNPPPRRQRPQRPPPPRUPRPOQRD5QRPPPRPUBANPPRRQPRQRORPPPPPPPRRRNDQQPNPMMPPPMMLPPMOPPMPPRRQPRUQPPRPPPRNPPNRQDRQPNOPPPRRPPPQPRRTKLPPPM9RPPBAPGQUR5PQRONPPRPPPPQRURDQRPPPRPPNORUPQRPQRPPPRPPNPRPBAPQRURDNONPPQPRRQPPRUPPPNRPPRNQPRQOPRRPPPRPPRQDN7RNPP5PPQRRQPRPPPPORPNPPQRPQPMMPNPRPPNPNRADQRRQPRUOPPR9PPN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7032 5662 4942
Agility 721 138 20
Stamina 7677 6053 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150433 127767 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.59% 18.59% 982
Spell Crit 9.56% 4.56% 818
Spell Haste 23.65% 17.76% 2274
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16866 12455 190
Melee Hit 8.18% 8.18% 982
Melee Crit 12.52% 5.13% 818
Melee Haste 35.42% 17.76% 2274
Expertise 16.12 16.12 484
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.26% 14.26% 1123

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
tabard empty

Talents

Blood Rank
Butchery 2
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 1
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 0
Icy Reach 0
Nerves of Cold Steel 0
Annihilation 0
Lichborne 0
On a Pale Horse 0
Endless Winter 0
Merciless Combat 0
Chill of the Grave 0
Killing Machine 0
Rime 0
Pillar of Frost 0
Improved Icy Talons 0
Brittle Bones 0
Chilblains 0
Hungering Cold 0
Improved Frost Presence 0
Threat of Thassarian 0
Might of the Frozen Wastes 0
Howling Blast 0
Unholy Rank
Unholy Command 1
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 3
Runic Corruption 2
Unholy Frenzy 1
Contagion 2
Shadow Infusion 3
Death's Advance 0
Magic Suppression 3
Rage of Rivendare 3
Unholy Blight 1
Anti-Magic Zone 1
Improved Unholy Presence 2
Dark Transformation 1
Ebon Plaguebringer 2
Sudden Doom 3
Summon Gargoyle 1

Profile

#!./simc

deathknight=Death_Knight_Unholy_2h_T11_372
origin="http://chardev.org/?profile=87453"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-203100000000000000000000000000000000000013300321230331121231
glyphs=blood_boil/pestilence/antimagic_shell/horn_of_winter/blood_tap/raise_ally/scourge_strike/raise_dead/death_coil
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/raise_dead
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/unholy_frenzy,if=!buff.bloodlust.react|target.time_to_die<=45
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/icy_touch,if=dot.frost_fever.remains<3
actions+=/plague_strike,if=dot.blood_plague.remains<3
actions+=/dark_transformation
actions+=/summon_gargoyle,time<=60
actions+=/summon_gargoyle,if=buff.bloodlust.react
actions+=/summon_gargoyle,if=buff.unholy_frenzy.react
actions+=/death_and_decay,if=death=4
actions+=/death_and_decay,if=unholy=2
actions+=/scourge_strike,if=death=4
actions+=/scourge_strike,if=unholy=2
actions+=/festering_strike,if=blood=2&frost=2
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/death_and_decay
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil
actions+=/blood_tap,if=unholy=0&inactive_death=1
actions+=/empower_rune_weapon,if=unholy=0
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_mastery,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=crit_hit,gems=20hit_20str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=20haste_20str_40str_10str,suffix=223
legs=sky_strider_greaves_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_578sta_345str_238haste_238mastery,reforge=mastery_hit,gems=40str_20hit_20str_20str,enchant=190ap_55crit,suffix=176
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=20hit_20str_10str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_mastery,gems=20haste_20str_67str_10str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=20hit_20str_67str_10str,enchant=50str
finger1=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_hit
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=20haste_20str_10str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_haste,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_hit,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_haste,gems=67str
# Gear Summary # gear_strength=4942
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=484
# gear_hit_rating=982
# gear_crit_rating=818
# gear_haste_rating=2274
# gear_mastery_rating=1123
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_1h_T11_372_PTR : 29000dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
29000.1 12.02 / 0.04% 3029.7 9.6 9.7 runic_power 0.48% 47.7
Origin http://chardev.org/?profile=75143
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:17757|16592|11914|3628|2706|1809|1685|756&chds=0,35514&chco=2459FF,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++17757++howling_blast,2459FF,0,0,15|t++16592++obliterate,C79C6E,1,0,15|t++11914++frost_strike,2459FF,2,0,15|t++3628++plague_strike,C79C6E,3,0,15|t++2706++melee_main_hand,C79C6E,4,0,15|t++1809++melee,C79C6E,5,0,15|t++1685++melee_off_hand,C79C6E,6,0,15|t++756++melee,C79C6E,7,0,15&chtt=Death_Knight_Frost_1h_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:19,17,12,12,11,9,6,4,3,3,2,1,0,0,0,0&chds=0,100&chco=C79C6E,2459FF,2459FF,C79C6E,2459FF,C79C6E,C79C6E,2459FF,9482C9,C79C6E,C79C6E,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|howling_blast|obliterate_offhand|frost_strike_offhand|melee_main_hand|melee_off_hand|frost_fever|blood_plague|claw|melee|razorice|plague_strike|melee|plague_strike_offhand|claw&chtt=Death_Knight_Frost_1h_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:UVgy71nrtwvsw011xvw0zxuswyxvtrv0zurprwwuropsutromklnqqpomlmoomkkkmprssssrrrsttttsrrsstttsrrrrsttstttsssssrqqqrrssssssssttsqonnoppqqqrsstuuuutttttuuuttssstttttsssttuvvuuuuuuuuuuuuuuvutrqqqqqrrrrsssstuvvuvvvwvvvvvuuvvvvuuuvvvvvvvvvwxxxwwwwwvvvvutrqqppppooppqpppqqqqqrssstttttuuuuuuuuuvvvvvvvvvvvvvvwwwwwvvutsrqpooooooppppppppqqqqqrrstttuuvvvvwwwwwwxxxxxxxxxxxxxyxyyyyyxxxwwwvvwwwwwwwwwwwxxxxxxxxxxxyyyyzzzzzzzzzzzzzzyyyyxxyxxxxwwvvvuttttstttttttttttttttu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Death_Knight_Frost_1h_T11_372_PTR+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z022334456577777766543200yxwvutssrrqqqpppoooooonnnnnnnllmmllllllllkkkkjjiiiiihhggfffeeeddccccccccccddddeeeffgghhiiijjjjkjjjjjiiiiiiiihhhhgggfggfffffeeeedddcccccccccccccccccccddddeeeefffffffggggghhhhhhiiiiiiijjjkkklllllmllllllllkkkkkjjjjiiiiiiiiiiiiiiiiihhhhhggggfffffeeeeeeeeeeeeeeeeefeeeeeeeeeeeeeeeeefffgghhiijjklllmlmmmmmllllllkkkjjjiiiiiiiiiiiihhhhhhgggggggggghhhiiijjkllmmnnnoooonnnnnmmmlllkkkkkkkkkkkkkklllllmmmmmnnnnnnoooooooooooooonnnnnnnnnnmmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=29000|max=48563&chxp=1,1,60,100&chtt=Death_Knight_Frost_1h_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,4,2,11,11,18,31,34,72,91,154,176,233,297,400,449,496,592,573,670,675,723,671,615,564,463,426,338,283,239,181,155,119,68,60,45,18,13,8,9,5,3,2,0,0,0,0,0,1&chds=0,723&chbh=5&chxt=x&chxl=0:|min=26786|avg=29000|max=31867&chxp=0,1,44,100&chtt=Death_Knight_Frost_1h_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T11_372_PTR 29000
blood_plague 911 3.1% 21.0 33.38sec 19641 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2323 4857 17.0% 0.0% 99.3%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.97 20.97 149.59 149.59 0.0000 3.0000 411930
Direct Results Count Pct Average Min Max Total Damage
hit 21.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.2 83.00% 2322.86 1633 3785 288384
crit 25.4 17.00% 4857.07 3414 7911 123546

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 6.1 76.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.11 6.11 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.1 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.8 330.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.81 1.81 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.8 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1277 4.4% 79.5 5.71sec 7257 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3241 6774 17.0% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.54 79.54 150.28 150.28 0.0000 3.0000 577163
Direct Results Count Pct Average Min Max Total Damage
hit 79.5 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.8 83.03% 3240.88 2227 5418 404369
crit 25.5 16.97% 6773.80 4654 11323 172793

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 5012 17.3% 133.5 3.36sec 16975 11914 12756 26278 42117 31.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
133.46 133.46 0.00 0.00 1.4247 0.0000 2265566
Direct Results Count Pct Average Min Max Total Damage
hit 91.8 68.80% 12755.83 9140 20445 1171239
crit 41.6 31.20% 26277.95 18946 42117 1094327

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage plus $s1 as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
frost_strike_offhand 3138 10.8% 133.5 3.36sec 10626 0 7983 16446 26330 31.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
133.46 133.46 0.00 0.00 0.0000 0.0000 1418237
Direct Results Count Pct Average Min Max Total Damage
hit 91.8 68.77% 7983.38 5715 12782 732740
crit 41.7 31.23% 16446.26 11846 26330 685497

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:runic_power
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% offhand weapon damage plus a bonus as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:139.53
  • base_dd_max:139.53
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
howling_blast 3479 12.0% 73.8 6.09sec 21304 17757 18657 39010 64660 14.7% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
73.81 73.81 0.00 0.00 1.1998 0.0000 1572525
Direct Results Count Pct Average Min Max Total Damage
hit 61.5 83.38% 18656.88 12750 31989 1148221
crit 10.9 14.74% 39010.40 26862 64660 424304
miss 1.4 1.89% 0.00 0 0 0

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.48)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.48)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1369.63
  • base_dd_max:1513.20
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 2703 9.3% 294.1 1.54sec 4155 2706 4729 9740 14771 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
294.08 294.08 0.00 0.00 1.5354 0.0000 1222010
Direct Results Count Pct Average Min Max Total Damage
hit 133.1 45.27% 4728.60 3480 7170 629514
crit 35.1 11.94% 9740.24 7168 14771 341963
glance 70.7 24.03% 3545.94 2610 5378 250533
miss 55.2 18.77% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1684 5.8% 293.5 1.54sec 2593 1685 2953 6083 9232 11.9% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
293.46 293.46 0.00 0.00 1.5386 0.0000 761028
Direct Results Count Pct Average Min Max Total Damage
hit 132.8 45.25% 2953.09 2160 4481 392181
crit 35.0 11.91% 6083.12 4480 9232 212672
glance 70.5 24.02% 2215.28 1631 3361 156175
miss 55.2 18.81% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 5413 18.7% 103.8 4.36sec 23562 16592 17150 35572 55431 34.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.84 103.84 0.00 0.00 1.4201 0.0000 2446643
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 65.19% 17150.06 12498 26908 1160951
crit 36.1 34.81% 35572.25 25746 55431 1285692

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage plus $s1. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
obliterate_offhand 3386 11.7% 103.8 4.36sec 14741 0 10732 22254 33696 34.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.84 103.84 0.00 0.00 0.0000 0.0000 1530629
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 65.21% 10731.93 7811 16818 726655
crit 36.1 34.79% 22253.99 16091 33696 803974

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% offhand weapon damage plus a bonus. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:325.19
  • base_dd_max:325.19
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.73sec 0 0 0 0 0 0.0% 1.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.25 7.25 0.00 0.00 1.1986 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.1 98.13% 0.00 0 0 0
miss 0.1 1.87% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 61.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.88 7.88 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.9 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 80 0.3% 6.9 65.65sec 5197 3628 4609 9490 14173 12.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 1.4324 0.0000 36012
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 87.95% 4608.97 3613 6880 28087
crit 0.8 12.05% 9489.83 7442 14173 7926

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 50 0.2% 6.9 65.65sec 3245 0 2881 5941 8857 11.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 22484
Direct Results Count Pct Average Min Max Total Damage
hit 6.1 88.11% 2881.14 2257 4300 17591
crit 0.8 11.89% 5941.03 4650 8857 4893

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% offhand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:210.42
  • base_dd_max:210.42
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
razorice 254 0.9% 483.1 0.94sec 238 0 238 0 338 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
483.12 483.12 0.00 0.00 0.0000 0.0000 114796
Direct Results Count Pct Average Min Max Total Damage
hit 483.1 100.00% 237.61 181 338 114796

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:949.00
  • base_dd_max:1764.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
pet - army_of_the_dead_ghoul_8 1295
claw 559 43.1% 12.0 3.09sec 1629 0 1491 2983 2983 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 19552
Direct Results Count Pct Average Min Max Total Damage
hit 10.9 90.75% 1491.43 1491 1491 16242
crit 1.1 9.25% 2982.86 2983 2983 3310

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 736 56.9% 21.0 1.62sec 1227 756 1189 2379 2379 9.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 21.00 0.00 0.00 1.6225 0.0000 25775
Direct Results Count Pct Average Min Max Total Damage
hit 14.0 66.83% 1189.27 1189 1189 16690
crit 1.9 9.20% 2378.55 2379 2379 4594
glance 5.0 23.97% 891.95 892 892 4491

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1667
claw 947 56.8% 105.7 3.83sec 3676 0 3366 6733 8749 9.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
105.75 105.75 0.00 0.00 0.0000 0.0000 388722
Direct Results Count Pct Average Min Max Total Damage
hit 96.0 90.80% 3366.27 2497 4374 323243
crit 9.7 9.20% 6732.81 4993 8749 65479

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 720 43.2% 124.5 3.23sec 2374 1809 2300 4598 5847 9.2% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
124.46 124.46 0.00 0.00 1.3123 0.0000 295412
Direct Results Count Pct Average Min Max Total Damage
hit 83.3 66.89% 2300.17 1714 2923 191496
crit 11.4 9.18% 4597.76 3429 5847 52516
glance 29.8 23.93% 1725.83 1286 2192 51399

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_1h_T11_372_PTR
frost_strike runic_power 98.7% 530.5 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.7 40
pet - ghoul
claw energy 100.0% 91.9 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1808.8 88.0 0.0 2.7%
chill_of_the_grave runic_power 176.3 1704.6 9.7 3.3%
frost_presence runic_power 113.4 199.9 1.8 1.7%
horn_of_winter runic_power 2.1 21.5 10.0 0.0%
improved_frost_presence runic_power 21.1 15.9 0.8 0.1%
rune_abilities runic_power 134.5 2372.0 17.6 2.4%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 392.2 2.8 0.0%
pet - ghoul energy
energy_regen energy 667.5 3977.9 6.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.7 0.0 54.9sec 54.9sec 28% 28%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
frost_presence 2.0 0.0 55.5sec 55.5sec 88% 85%

Database details

  • id:
  • cooldown name:buff_frost_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 2.0 0.0 394.9sec 394.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.8 0.0 104.7sec 104.7sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 50.0 1.8 9.0sec 8.6sec 11% 21%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.9 0.0 61.3sec 61.3sec 34% 35%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 61.0 32.5 7.4sec 4.8sec 42% 82%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_razorice 1.0 482.1 0.0sec 0.9sec 100% 100%

Database details

  • id:
  • cooldown name:buff_rune_of_razorice
  • tooltip:(null)
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rune_of_the_fallen_crusader 10.8 30.9 42.5sec 10.7sec 75% 74%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 99.6 0.0sec 4.5sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 12% 13%

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 59.1 7.5sec
runic_empowerment_wasted 1.0 116.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.72%
σ of the average dps 6.0113
2 * σ / μ 0.0415%
95% Confidence Intervall ( μ ± 2σ ) ( 28988.06 - 29012.10 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28982.05 - 29018.12 )
Sample Data
σ 601.1269
Minimum 26786.43
Maximum 31867.26
Spread ( max - min ) 5080.82
Range ( max - min ) / 2 2540.41
Range% 8.76
10th Percentile 28264.28
90th Percentile 29807.48
( 90th Percentile - 10th Percentile ) 1543.20
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1718
0.1 scale factor error with delta=300 3212
0.05 scale factor error with delta=300 12848
0.01 scale factor error with delta=300 321203
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
3 presence,choose=unholy,if=buff.bloodlust.react
4 army_of_the_dead
5 snapshot_stats
6 blood_fury,time>=10
7 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
8 auto_attack
9 pillar_of_frost
A raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
B raise_dead,time>=15
C outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
D howling_blast,if=dot.frost_fever.remains<=2
E plague_strike,if=dot.blood_plague.remains<=2
F obliterate,if=frost=2&unholy=2
G obliterate,if=death=2
H obliterate,if=buff.killing_machine.react
I blood_tap,if=buff.killing_machine.react
J empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
K frost_strike,if=runic_power>=90&!buff.bloodlust.react
L frost_strike,if=runic_power>=95
M howling_blast,if=buff.rime.react
N howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
O obliterate
P empower_rune_weapon,if=target.time_to_die<=45
Q frost_strike
R howling_blast
S blood_tap
T empower_rune_weapon
U horn_of_winter

Sample Sequence

0124789C3FGGMLQOMO6LQQOGAIGLMHLMLOHLLMGLHLMQEHMLHLMGKMOKOKMKGKQOMQOMQO9KQOMQOQOCMQQ2HQNSRQTFGGKKHKMOKMOKMKEHKQOQQOQOMQHQU9QHMQ6HMQCOQOMHKIGKMKOKMGKMHKMKOHKKMEQOMKNQO9KOKGKMOKBMHKKMOKCGGKKMOKQOQNQOQQHMQOIGNKQEQ9UNQ6HMOKMQQOMNQQRONKCNQGMKOKNOKNKQQOOMQQIH9MQQENQOMNQQUOMOKQQOMNQQROQCUQRHMQNQRQOMQUH9MKQ6RQONBQIEQTFGGKKMOKGKMQHMGKKMOKMOCKOKMKOKM9OKGKKMOKMGKMOHKEIKMOKOKQOQQRQROQQURQHMQCOM9H7KM6QQGHMKOKOKMQQOHMQQEQOMOMQQOMQHMIQGMOKO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6983 5625 4957
Agility 721 138 20
Stamina 7590 5970 5780
Intellect 55 53 20
Spirit 85 85 20
Health 149215 126605 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 15.11% 15.11% 626
Spell Crit 13.79% 8.79% 1576
Spell Haste 17.66% 12.06% 1544
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16756 12380 190
Melee Hit 8.21% 8.21% 626
Melee Crit 16.75% 9.36% 1576
Melee Haste 12.06% 12.06% 1544
Expertise 26.91 26.91 808
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.94% 12.94% 886

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
shirt empty
chest magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
tabard empty

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 0
Nerves of Cold Steel 3
Annihilation 3
Lichborne 0
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 3
Might of the Frozen Wastes 0
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_1h_T11_372_PTR
origin="http://chardev.org/?profile=75143"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003033001223311201230103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=frost,if=!buff.bloodlust.react&runic_power<=20
actions+=/presence,choose=unholy,if=buff.bloodlust.react
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,reforge=mastery_haste,gems=40str,enchant=50str_25crit
chest=magma_plated_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_landslide,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180hit_180exp,reforge=exp_haste,gems=40str_67str,suffix=221
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=mastery_crit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=mastery_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=mastery_crit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,ilevel=372,quality=epic,stats=247sta_165str_110hit_110exp,reforge=hit_haste,enchant=rune_of_razorice,weapon=sword_2.60speed_949min_1764max,suffix=121
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=rune_of_the_fallen_crusader,weapon=sword_2.60speed_949min_1764max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,gems=40str
# Gear Summary # gear_strength=4957
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=808
# gear_hit_rating=626
# gear_crit_rating=1576
# gear_haste_rating=1544
# gear_mastery_rating=886
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=stormwake_the_tempests_reach_of_the_landslide,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_razorice
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_2h_T11_372_PTR : 28955dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28955.4 14.60 / 0.05% 2142.2 13.5 13.6 runic_power 6.00% 59.8
Origin http://chardev.org/?profile=61432
Talents http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
Glyphs
  • horn_of_winter
  • frost_strike
  • howling_blast
  • obliterate

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31607|23964|17267|7339|3778|1790|854&chds=0,63213&chco=C79C6E,2459FF,2459FF,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31607++obliterate,C79C6E,0,0,15|t++23964++frost_strike,2459FF,1,0,15|t++17267++howling_blast,2459FF,2,0,15|t++7339++plague_strike,C79C6E,3,0,15|t++3778++melee_main_hand,C79C6E,4,0,15|t++1790++melee,C79C6E,5,0,15|t++854++melee,C79C6E,6,0,15&chtt=Death_Knight_Frost_2h_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:35,28,13,12,4,3,3,2,0,0,0&chds=0,100&chco=2459FF,C79C6E,C79C6E,2459FF,2459FF,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=frost_strike|obliterate|melee_main_hand|howling_blast|frost_fever|claw|blood_plague|melee|plague_strike|melee|claw&chtt=Death_Knight_Frost_2h_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:Qiy72qmpstusqqtutsrrsrpqqrqonoqsqnkmonommllmmkjhhhjjihgffghhfcbdehiigggggfgeeeeeedccccccbbaaZaaaZZZYZYYXYWWWXXXXWWWWXYXXWUSSTTUUUVWXaaZYYZYZYYXYXXYYYXXWXXXXXWWWWWWXXXVVVWVVVVVVWWWWWVUTTSTTTUVWXXXXXYabbaaZZZZZZYYXXYYYXXWXWXXXXWWWXXYYXWWWWWWWWWVUTTSSSTTUVVVVVVVWWWWXYYZZZZYYXXYYYXXWXXYXXXXXXXXXXXXXYYYXWWVVUTTSSSTTUUUUUVVWVWVVVWWWWXYYZZaZZZZYZZZaZZZZaabbbabbccdcddeefeeddccccccccccccccbbbbbbaaaaaabbcccbcbbbbbaaaaaaZZZZZZZYYYYYXWWWVVUUUUUUUUUVVVVVVVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=124&chtt=Death_Knight_Frost_2h_T11_372_PTR+Runic Power+Timeline&chts=dddddd,18&chco=C41F3B http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z01123445557777777766543210zyxwvuutttsssrrrrrqqqqqqqqqoppppppppopoooonnnnmmmmllkkkjjiiihhggffffffffffffffgggghhhiiiijjjjjjjjkkllllllllllllkkklkkjjjiihhgggffffefeeeeeeeeeeeeedeeeefffgggghghhiiijjkkkklllllllllmlmlmlllmmmmmmmmlmmmmmmmmmmllllllllllllllllllkkkkkkjkjjjjiiiihhhhhhhhhhhhhhhhhhgggggggggggggfgggggghhiiijjkkkklllllllllmlmlmllmlllmlmmnmnnnnmnmnmmmmllllllmmmmnnnooppqqrrssssssssrrqqqqppooooonnnnnnnnnoooooooooooonnnnnnnnnnnnnnooooooopoppppppppppp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28955|max=45373&chxp=1,1,64,100&chtt=Death_Knight_Frost_2h_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,0,4,5,8,8,17,27,33,63,78,114,136,171,221,268,322,334,449,467,503,553,569,541,606,594,549,518,458,422,367,323,260,222,181,147,109,97,81,49,42,23,19,15,12,3,3,2,1,2&chds=0,606&chbh=5&chxt=x&chxl=0:|min=26410|avg=28955|max=31732&chxp=0,1,48,100&chtt=Death_Knight_Frost_2h_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T11_372_PTR 28955
blood_plague 789 2.7% 14.2 33.07sec 25145 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2120 4429 11.5% 0.0% 99.3%

Stats details: blood_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.19 14.19 149.56 149.56 0.0000 3.0000 356759
Direct Results Count Pct Average Min Max Total Damage
hit 14.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 132.4 88.50% 2119.87 1647 3431 280576
crit 17.2 11.50% 4428.66 3441 7170 76183

Action details: blood_plague

Static Values
  • id:59879
  • school:shadow
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Shadow damage every 3 sec for $55078d. Caused by Plague Strike and other abilities.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:38.06
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 7.0 66.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.02 7.02 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.0 100.00% 0.00 0 0 0

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:health
  • tree:blood
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Blood Rune converted to a Death Rune.
  • description:Immediately activates a Blood Rune and converts it into a Death Rune for the next $d. Death Runes count as a Blood, Frost or Unholy Rune.
Rune Information
  • Blood Cost:1
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 307.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.94 1.94 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 1028 3.6% 97.4 4.66sec 4774 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2749 5743 11.5% 0.0% 99.7%

Stats details: frost_fever

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
97.38 97.38 150.28 150.28 0.0000 3.0000 464868
Direct Results Count Pct Average Min Max Total Damage
hit 97.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.0 88.51% 2749.36 2128 4447 365726
crit 17.3 11.49% 5743.34 4447 9295 99142

Action details: frost_fever

Static Values
  • id:59921
  • school:frost
  • resource:unknown
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A disease dealing ${$m1*1.15+$AP*0.055*1.15} Frost damage every 3 sec and reducing the target's melee and ranged attack speed by $55095s2% for $55095d. Caused by Icy Touch and other spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.063250
  • base_td:31.28
  • num_ticks:11
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 10191 35.2% 190.9 2.35sec 24125 23964 18189 37479 56606 30.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
190.93 190.93 0.00 0.00 1.0067 0.0000 4606366
Direct Results Count Pct Average Min Max Total Damage
hit 132.0 69.14% 18189.47 14853 27479 2401105
crit 58.8 30.82% 37479.27 30597 56606 2205261
miss 0.1 0.05% 0.00 0 0 0

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage plus $s1 as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:277.93
  • base_dd_max:277.93
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
howling_blast 3468 12.0% 90.1 4.96sec 17406 17267 15781 32992 54857 9.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.06 90.06 0.00 0.00 1.0081 0.0000 1567569
Direct Results Count Pct Average Min Max Total Damage
hit 81.6 90.56% 15780.92 12151 26247 1286964
crit 8.5 9.44% 32992.21 25396 54857 280605

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:unknown
  • tree:frost
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.48)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.48)))} Frost damage to all other enemies within $A2 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:1369.63
  • base_dd_max:1513.20
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 3772 13.0% 223.0 2.03sec 7644 3778 7583 15614 22335 6.5% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
223.04 223.04 0.00 0.00 2.0234 0.0000 1704885
Direct Results Count Pct Average Min Max Total Damage
hit 155.0 69.50% 7583.03 6319 10842 1175507
crit 14.4 6.47% 15613.94 13018 22335 225270
glance 53.5 23.98% 5686.28 4739 8132 304108
miss 0.1 0.05% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 8009 27.7% 113.5 3.99sec 31908 31607 24435 50724 74903 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
113.45 113.45 0.00 0.00 1.0095 0.0000 3620113
Direct Results Count Pct Average Min Max Total Damage
hit 81.1 71.49% 24435.35 20050 36361 1981875
crit 32.3 28.47% 50724.30 41304 74903 1638238
miss 0.1 0.04% 0.00 0 0 0

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:unknown
  • tree:frost
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage plus $s1. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:650.38
  • base_dd_max:650.38
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
outbreak 0 0.0% 7.3 66.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.33 7.33 0.00 0.00 1.0142 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:mana
  • tree:unholy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 61.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.89 7.89 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 7.9 100.00% 0.00 0 0 0

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:unknown
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Strength increased by $s1%. Immune to movement from external sources.
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement such as knockbacks. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_strike 113 0.4% 6.9 66.39sec 7408 7339 6938 14303 20756 6.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.86 6.86 0.00 0.00 1.0095 0.0000 50856
Direct Results Count Pct Average Min Max Total Damage
hit 6.4 93.53% 6937.59 6148 10076 44544
crit 0.4 6.43% 14303.20 12665 20756 6312
miss 0.0 0.04% 0.00 0 0 0

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:unknown
  • tree:unholy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:420.84
  • base_dd_max:420.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead_ghoul_8 1445
claw 604 41.8% 13.0 2.78sec 1625 0 1491 2983 2983 9.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.00 13.00 0.00 0.00 0.0000 0.0000 21130
Direct Results Count Pct Average Min Max Total Damage
hit 11.8 90.85% 1491.43 1491 1491 17615
crit 1.2 9.07% 2982.86 2983 2983 3516
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.04% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.003050
  • weapon_multiplier:1.25
melee 841 58.2% 24.0 1.44sec 1227 854 1189 2379 2379 9.3% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.00 24.00 0.00 0.00 1.4365 0.0000 29447
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 66.65% 1189.27 1189 1189 19024
crit 2.2 9.26% 2378.55 2379 2379 5283
glance 5.8 24.01% 891.95 892 892 5140
dodge 0.0 0.03% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.002550
  • weapon_multiplier:1.00
pet - ghoul 1622
claw 905 55.8% 110.0 3.68sec 3379 0 3097 6196 7643 9.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
109.98 109.98 0.00 0.00 0.0000 0.0000 371675
Direct Results Count Pct Average Min Max Total Damage
hit 99.8 90.72% 3097.20 2184 3822 309021
crit 10.1 9.19% 6196.30 4368 7643 62655
dodge 0.0 0.04% 0.00 0 0 0
miss 0.0 0.04% 0.00 0 0 0

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.052500
  • weapon_multiplier:1.25
melee 717 44.2% 135.3 2.97sec 2178 1790 2112 4224 5107 9.2% 0.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
135.29 135.29 0.00 0.00 1.2168 0.0000 294653
Direct Results Count Pct Average Min Max Total Damage
hit 90.3 66.74% 2112.48 1499 2553 190744
crit 12.4 9.18% 4223.87 2998 5107 52471
glance 32.5 23.99% 1584.91 1124 1915 51438
dodge 0.1 0.04% 0.00 0 0 0
miss 0.1 0.05% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.042250
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Death_Knight_Frost_2h_T11_372_PTR
frost_strike runic_power 100.0% 753.9 32
pet - army_of_the_dead_ghoul_8
claw energy 100.0% 40.6 40
pet - ghoul
claw energy 100.0% 84.5 40
Resource Gains Type Count runic_power Average Overflow
butchery runic_power 1808.8 89.1 0.0 1.5%
chill_of_the_grave runic_power 203.5 1987.1 9.8 2.3%
horn_of_winter runic_power 10.7 107.3 10.0 0.0%
improved_frost_presence runic_power 173.6 116.1 0.7 0.6%
might_of_the_frozen_wastes runic_power 100.4 982.0 9.8 2.1%
power_refund runic_power 0.1 2.6 28.8 0.0%
rune_abilities runic_power 173.6 2876.1 16.6 1.5%
pet - army_of_the_dead_ghoul_8 energy
energy_regen energy 140.0 443.0 3.2 0.0%
pet - ghoul energy
energy_regen energy 668.0 4162.7 6.2 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.2 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 8.1 0.0 58.2sec 58.2sec 27% 27%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
golemblood_potion 2.0 0.0 394.6sec 394.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 108.2sec 108.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
killing_machine 68.6 1.9 6.6sec 6.4sec 14% 23%

Database details

  • id:
  • cooldown name:buff_killing_machine
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
pillar_of_frost 7.9 0.0 61.2sec 61.2sec 34% 34%

Database details

  • id:
  • cooldown name:buff_pillar_of_frost
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
rime 47.8 3.2 9.4sec 8.8sec 18% 53%

Database details

  • id:
  • cooldown name:buff_rime
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:45.00%
rune_of_the_fallen_crusader 7.6 60.1 60.6sec 6.6sec 90% 88%

Database details

  • id:
  • cooldown name:buff_rune_of_the_fallen_crusader
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 125.5 0.0sec 3.6sec 99% 100%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
army_of_the_dead_ghoul_8-bloodlust 1.0 0.0 0.0sec 0.0sec 100% 100%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
ghoul-bloodlust 0.3 0.0 0.0sec 0.0sec 3% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
unholy_presence

Database details

  • id:
  • cooldown name:buff_unholy_presence
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
runic_empowerment 85.2 5.2sec
runic_empowerment_wasted 0.7 97.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.49%
σ of the average dps 7.3024
2 * σ / μ 0.0504%
95% Confidence Intervall ( μ ± 2σ ) ( 28940.84 - 28970.05 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28933.54 - 28977.35 )
Sample Data
σ 730.2391
Minimum 26409.59
Maximum 31732.34
Spread ( max - min ) 5322.75
Range ( max - min ) / 2 2661.38
Range% 9.19
10th Percentile 28051.09
90th Percentile 29926.62
( 90th Percentile - 10th Percentile ) 1875.53
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2544
0.1 scale factor error with delta=300 4739
0.05 scale factor error with delta=300 18959
0.01 scale factor error with delta=300 473999
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 presence,choose=unholy
3 army_of_the_dead
4 snapshot_stats
5 blood_fury,time>=10
6 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
7 auto_attack
8 pillar_of_frost
9 raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
A raise_dead,time>=15
B outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
C howling_blast,if=dot.frost_fever.remains<=2
D plague_strike,if=dot.blood_plague.remains<=2
E obliterate,if=frost=2&unholy=2
F obliterate,if=death=2
G obliterate,if=buff.killing_machine.react
H blood_tap,if=buff.killing_machine.react
I empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
J frost_strike,if=runic_power>=90&!buff.bloodlust.react
K frost_strike,if=runic_power>=95
L howling_blast,if=buff.rime.react
M howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
N obliterate
O empower_rune_weapon,if=target.time_to_die<=45
P frost_strike
Q howling_blast
R blood_tap
S empower_rune_weapon
T horn_of_winter

Sample Sequence

0123678BEFF9HKKLNK5LFKKLNKFFKKLPNPPPQSEFFKKLPDPNPPGPQQPTNLPPQPMNPQPP8GPNPBPRNLNPPQPMTNPPQPMPNLPFPQPNPQPTMDPQPQPNPNLPNLGJLJPNL8PPTNPRQM5PPBNGJLMJPPFLNLJNJLNJLJNJLJFJLGJDJLGNJLJNJFJLJNJNJ8LANJLJPNLMJPHPQPBFFPPTGPGPMPNLPPENLPPNPNPQPDTGPQP8PFPNPQ5PNLNJPMPRQNLPPPBTGLMPMPPNLNJPNJGJGJLPNLJNJPPQPNMPPTD8PGLNJPPQQNPPRQPTGPNLPNLBNJPNJPSEFFJJLMJNJFJLJNJNJLJNJL8ANJPDP5NLPNPPPQNPTPQHQPNPPNLPQPMPNPBTGLPPQPMPGPPGLPFPNLPNPP8PTGPPDQPNPNLPNPMMPPNPQPQNLPPQPMPRNPTPBMNPNLPPNLNJLNJLJNJL68PNJLP5ENJGJJPNDJNJPPNPGLPNLJPNNJJLMJNGJJLJPNNJNBHJLJNJNJPP

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7046 5685 5012
Agility 721 138 20
Stamina 7677 6053 5863
Intellect 55 53 20
Spirit 85 85 20
Health 150433 127767 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 18.32% 18.32% 955
Spell Crit 8.29% 3.29% 590
Spell Haste 20.82% 15.06% 1929
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 16895 12501 190
Melee Hit 7.95% 7.95% 955
Melee Crit 11.25% 3.86% 590
Melee Haste 26.57% 15.06% 1929
Expertise 26.24 26.24 788
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.98% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.01% 15.01% 1257

Gear

Encoded
head magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard tabard_of_ramkahen,ilevel=85

Talents

Blood Rank
Butchery 1
Blade Barrier 0
Bladed Armor 3
Improved Blood Tap 0
Scent of Blood 0
Scarlet Fever 0
Hand of Doom 0
Blood-Caked Blade 0
Bone Shield 0
Toughness 0
Abomination's Might 0
Sanguine Fortitude 0
Blood Parasite 0
Improved Blood Presence 0
Will of the Necropolis 0
Rune Tap 0
Vampiric Blood 0
Improved Death Strike 0
Crimson Scourge 0
Dancing Rune Weapon 0
Frost Rank
Runic Power Mastery 3
Icy Reach 2
Nerves of Cold Steel 0
Annihilation 3
Lichborne 1
On a Pale Horse 0
Endless Winter 1
Merciless Combat 2
Chill of the Grave 2
Killing Machine 3
Rime 3
Pillar of Frost 1
Improved Icy Talons 1
Brittle Bones 2
Chilblains 0
Hungering Cold 1
Improved Frost Presence 2
Threat of Thassarian 0
Might of the Frozen Wastes 3
Howling Blast 1
Unholy Rank
Unholy Command 0
Virulence 3
Epidemic 3
Desecration 0
Resilient Infection 0
Morbidity 0
Runic Corruption 0
Unholy Frenzy 0
Contagion 0
Shadow Infusion 0
Death's Advance 0
Magic Suppression 0
Rage of Rivendare 0
Unholy Blight 0
Anti-Magic Zone 0
Improved Unholy Presence 0
Dark Transformation 0
Ebon Plaguebringer 0
Sudden Doom 0
Summon Gargoyle 0

Profile

#!./simc

deathknight=Death_Knight_Frost_2h_T11_372_PTR
origin="http://chardev.org/?profile=61432"
level=85
race=orc
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#deathknight-103000000000000000003203101223311201203103300000000000000000
glyphs=horn_of_winter/frost_strike/howling_blast/obliterate
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/presence,choose=unholy
actions+=/army_of_the_dead
actions+=/snapshot_stats
actions+=/blood_fury,time>=10
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_attack
actions+=/pillar_of_frost
actions+=/raise_dead,if=buff.rune_of_the_fallen_crusader.react&buff.heart_of_rage.react
actions+=/raise_dead,time>=15
actions+=/outbreak,if=dot.frost_fever.remains<=2|dot.blood_plague.remains<=2
actions+=/howling_blast,if=dot.frost_fever.remains<=2
actions+=/plague_strike,if=dot.blood_plague.remains<=2
actions+=/obliterate,if=frost=2&unholy=2
actions+=/obliterate,if=death=2
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=buff.killing_machine.react
actions+=/empower_rune_weapon,if=target.time_to_die<=120&buff.killing_machine.react
actions+=/frost_strike,if=runic_power>=90&!buff.bloodlust.react
actions+=/frost_strike,if=runic_power>=95
actions+=/howling_blast,if=buff.rime.react
actions+=/howling_blast,if=(death+unholy)=0&!buff.bloodlust.react
actions+=/obliterate
actions+=/empower_rune_weapon,if=target.time_to_die<=45
actions+=/frost_strike
actions+=/howling_blast
actions+=/blood_tap
actions+=/empower_rune_weapon
actions+=/horn_of_winter
head=magma_plated_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20haste_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=mastery_haste
shoulders=magma_plated_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,gems=40str_10haste,enchant=50str_25crit
chest=battleplate_of_ancient_kings,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_217exp_257haste_578sta_345str,reforge=exp_mastery,gems=40str_40str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,gems=40str_67str,suffix=223
legs=magma_plated_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_haste,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=exp_haste,gems=40str,enchant=50haste
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=crit_hit,gems=40str_67str,enchant=50str
hands=magma_plated_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_haste,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=crit_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_haste,enchant=rune_of_the_fallen_crusader,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=crit_hit,gems=40str
tabard=tabard_of_ramkahen,ilevel=85
# Gear Summary # gear_strength=5012
# gear_agility=20
# gear_stamina=5863
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=788
# gear_hit_rating=955
# gear_crit_rating=590
# gear_haste_rating=1929
# gear_mastery_rating=1257
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T11_372 : 25494dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25494.4 10.12 / 0.04% 21.2 1204.2 1179.9 mana 0.00% 41.4
Origin http://chardev.org/?profile=34049
Talents http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
Glyphs
  • focus
  • rebirth
  • starfall
  • mark_of_the_wild
  • unburdened_rebirth
  • dash
  • starsurge
  • insect_swarm
  • moonfire

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:88440|82427|74380|43161|32969|16853|16039|1925&chds=0,176880&chco=336600,69CCF0,69CCF0,336600,8AD0B1,69CCF0,336600,C79C6E&chm=t++88440++sunfire,336600,0,0,15|t++82427++moonfire,69CCF0,1,0,15|t++74380++starfall,69CCF0,2,0,15|t++43161++insect_swarm,336600,3,0,15|t++32969++starsurge,8AD0B1,4,0,15|t++16853++starfire,69CCF0,5,0,15|t++16039++wrath,336600,6,0,15|t++1925++treant_melee,C79C6E,7,0,15&chtt=Druid_Balance_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:25,23,13,12,11,7,6,2,0,0&chds=0,100&chco=336600,69CCF0,8AD0B1,69CCF0,336600,336600,69CCF0,C79C6E,336600,C41F3B&chl=wrath|starfire|starsurge|moonfire|insect_swarm|sunfire|starfall|treant_melee|wild_mushroom_detonate|darkmoon_card_volcano&chtt=Druid_Balance_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o1100zyyx1577665321100zzyxxxxy010zyxxwvvuuutttttvwy000000zzzyyyxxwwwvvvvvvvwxyzzzyyxwwvvuuuuttttuvwxyzzz00zzzzyyxxxwwwvvvvvwwxxxxyyxxxwwvvuuutttttuuvwxyzzzzzyyyxxxwwwvvvuuuvvwwxxxxxxwwvvuttsssssstttuuvvwwwwwwwvvvuutttttsstttuuvvvvvvuuutttsssssssstttuuuuvvvvvuuuutttssssssssstttuuuuuuuutttssssssssstttuuuuuuuuuutttsssssrrsssssstttuuuuuuuuttttssssstttuuuuuuuuuuutttsssrrrrrrrssttttuuuuuuuttttttssttttttuuuuuuutttttsssssssssstttuuvvvvvvvuuuuutttttttttttuu&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117908&chtt=Druid_Balance_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:wy345666655457743433565320zyyxxwwvvvuuttsrponmnoonnmnmnnnnnmmlkjjjjihgggggggggffgghiihhhhhhhhhiiiiijjkkkkllllmmllllkjjkkkkkkkjjkkkkkkkkkkkkkjjjjjjiiiihhghhhhhhgggffffffeeeefgghiijjklmmmmmmmnnonnnnmmmllkkkkjjkkkkkkkkkkkkkkkkkllmnnooopppooonmmllllkkjiihhggfffeeeeeeeeeeefffgghhhiijkllmmmmmmlllkjjiihhhhgggfffffffffffghhijjkllmnooopppppqqqpponnmlkjjihhggggggggggggghhhhiijklmmnoooppppppooooonnmlkkjiihhggffffffffffgghhiijkklmnooppqqqqqqqppoonnmmllkjjiihhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25494|max=40855&chxp=1,1,62,100&chtt=Druid_Balance_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,6,6,9,19,35,48,59,83,113,157,217,234,287,340,404,440,508,559,537,531,555,608,561,516,492,456,362,331,289,240,208,175,156,104,99,68,52,41,27,26,7,10,6,8,3,3,1&chds=0,608&chbh=5&chxt=x&chxl=0:|min=23784|avg=25494|max=27418&chxp=0,1,47,100&chtt=Druid_Balance_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Balance_T11_372 25494
darkmoon_card_volcano 71 0.3% 10.2 46.40sec 3129 0 2678 4140 4843 31.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.22 10.22 0.00 0.00 0.0000 0.0000 31973
Direct Results Count Pct Average Min Max Total Damage
hit 7.0 68.97% 2677.78 2567 3135 18876
crit 3.2 30.96% 4139.60 3966 4843 13098
miss 0.0 0.07% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
insect_swarm 2845 11.2% 26.0 17.75sec 49513 43161 0 0 0 0.0% 0.1% 0.0% 0.0% 304 3407 5190 45.9% 0.0% 99.7%

Stats details: insect_swarm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.97 25.97 304.37 304.37 1.1472 1.4808 1286038
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 99.93% 0.00 0 0 0
miss 0.0 0.07% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.7 54.11% 3407.22 2426 6380 561114
crit 139.7 45.89% 5189.76 3748 9858 724924

Action details: insect_swarm

Static Values
  • id:5570
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1490.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:$w1 Nature damage every $t1 sec.
  • description:The enemy target is swarmed by insects, causing $o1 Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:136.15
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
moonfire 3131 12.3% 15.4 30.26sec 92184 82427 4210 8868 15445 33.8% 0.1% 0.0% 0.0% 193 4574 9340 47.9% 0.0% 59.3%

Stats details: moonfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.35 15.35 193.46 193.46 1.1184 1.3854 1415188
Direct Results Count Pct Average Min Max Total Damage
hit 10.2 66.12% 4209.91 2828 7390 42734
crit 5.2 33.80% 8867.92 5911 15445 46012
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.8 52.10% 4573.72 2956 7954 461017
crit 92.7 47.90% 9339.51 6179 16624 865424

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional ${$m1*6*$} Arcane damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 1627 6.4% 8.9 49.82sec 83016 74380 0 0 0 0.0% 0.0% 0.0% 0.0% 87 6366 13419 29.1% 0.1% 19.3%

Stats details: starfall

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.86 8.86 87.39 87.39 1.1161 1.0000 735573
Direct Results Count Pct Average Min Max Total Damage
none 8.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 61.9 70.78% 6365.71 4174 10734 393784
crit 25.5 29.14% 13419.28 8723 22435 341789
miss 0.1 0.07% 0.00 0 0 0

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.247000
  • base_dd_min:368.70
  • base_dd_max:428.49

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • tree:balance
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6522.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
starfire 5917 23.2% 81.9 5.43sec 32674 16853 20678 47946 80890 44.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.86 81.86 0.00 0.00 1.9388 0.0000 2674821
Direct Results Count Pct Average Min Max Total Damage
hit 45.7 55.87% 20677.87 14752 38703 945814
crit 36.1 44.05% 47946.05 30831 80890 1729007
miss 0.1 0.07% 0.00 0 0 0

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:986.98
  • base_dd_max:1230.95
starsurge 3410 13.4% 37.5 12.12sec 41149 32969 26425 60666 98632 43.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.46 37.34 0.00 0.00 1.2481 0.0000 1541339
Direct Results Count Pct Average Min Max Total Damage
hit 21.1 56.51% 26424.76 17897 47192 557602
crit 16.2 43.42% 60666.10 37405 98632 983737
miss 0.0 0.07% 0.00 0 0 0

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2049.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:1017.72
  • base_dd_max:1405.43
sunfire 1740 6.8% 7.9 57.05sec 99912 88440 4986 10473 15445 34.1% 0.1% 0.0% 0.0% 96 5328 11232 38.7% 0.0% 30.7%

Stats details: sunfire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.87 7.87 96.23 96.23 1.1297 1.4426 786517
Direct Results Count Pct Average Min Max Total Damage
hit 5.2 65.78% 4985.93 4347 7390 25820
crit 2.7 34.13% 10473.17 9086 15445 28142
miss 0.0 0.08% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 59.0 61.31% 5328.22 4544 7954 314358
crit 37.2 38.69% 11232.48 9497 16624 418197

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional ${$m1*4*$} Nature damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.180000
  • base_dd_min:196.24
  • base_dd_max:239.85
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.180000
  • base_td:93.73
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 80 0.3% 1.0 0.00sec 36018 0 31332 48408 48408 27.6% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 36018
Direct Results Count Pct Average Min Max Total Damage
hit 0.7 72.36% 31331.87 31332 31332 22672
crit 0.3 27.57% 48407.74 48408 48408 13346
miss 0.0 0.07% 0.00 0 0 0

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.603200
  • base_dd_min:845.04
  • base_dd_max:1022.45
wrath 6290 24.7% 121.5 3.60sec 23393 16039 15307 34596 57410 42.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.55 121.16 0.00 0.00 1.4585 0.0000 2843375
Direct Results Count Pct Average Min Max Total Damage
hit 69.7 57.55% 15307.14 10425 27469 1067417
crit 51.3 42.37% 34595.52 21789 57410 1775958
miss 0.1 0.08% 0.00 0 0 0

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • tree:balance
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1677.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]$?s33891[ |C0033AA11Tree of Life: Cast time reduced by 50%, damage increased by 30%.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:675.17
  • base_dd_max:761.36
pet - treants 449
treant_melee 449 100.0% 60.7 6.39sec 2855 1925 3032 6064 7450 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: treant_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
60.75 60.75 0.00 0.00 1.4826 0.0000 173407
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 75.77% 3031.52 2754 3725 139526
crit 0.1 0.20% 6063.56 5507 7450 746
glance 14.6 24.00% 2272.53 2065 2794 33135
dodge 0.0 0.03% 0.00 0 0 0

Action details: treant_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.65
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Druid_Balance_T11_372
insect_swarm mana 6.9% 34.3 1445
moonfire mana 4.6% 56.7 1627
starfall mana 10.3% 13.1 6326
starfire mana 26.3% 18.7 1751
starsurge mana 12.4% 22.9 1799
sunfire mana 2.4% 61.4 1627
wrath mana 33.9% 15.4 1516
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29140.1 16.1 1.2%
euphoria mana 18.6 348265.9 18713.1 2.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101560.0 101560.0 0.0%
innervate mana 10.4 13924.8 1340.5 24.4%
mp5_regen mana 1808.8 83217.4 46.0 1.2%
omen_of_clarity none 21.5 41087.0 1906.7 0.0%
replenishment mana 1808.8 52967.5 29.3 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.2sec 104.2sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 220.3 0.0 2.0sec 2.0sec 78% 78%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
innervate 0.3 0.0 213.6sec 213.6sec 1% 100%

Database details

  • id:
  • cooldown name:buff_innervate
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.8sec 51.8sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
lunar_eclipse 9.1 0.0 49.4sec 49.4sec 27% 55%

Database details

  • id:48518
  • cooldown name:buff_lunar_eclipse
  • tooltip:Damage done by your arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
lunar_shower 23.2 0.0 19.9sec 19.9sec 15% 16%

Database details

  • id:81192
  • cooldown name:buff_lunar_shower
  • tooltip:Direct damage of your Moonfire increased by $s1%, and mana cost reduced by $s2%.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
natures_grace 19.4 0.0 23.9sec 23.9sec 63% 65%

Database details

  • id:
  • cooldown name:buff_natures_grace
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
omen_of_clarity 21.6 1.0 20.0sec 19.1sec 9% 10%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
power_torrent_mh 10.1 0.0 47.1sec 47.1sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shooting_stars 22.1 1.7 19.9sec 18.4sec 9% 57%

Database details

  • id:93400
  • cooldown name:buff_shooting_stars
  • tooltip:Cast time of your next Starsurge reduced by $s1%.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:4.00%
solar_eclipse 9.6 0.0 48.7sec 48.7sec 32% 54%

Database details

  • id:48517
  • cooldown name:buff_solar_eclipse
  • tooltip:Damage done by your nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_caster 18.6 0.0 24.4sec 24.4sec 24% 20%

Database details

  • id:
  • cooldown name:buff_t11_4pc_caster
  • tooltip:(null)
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
volcanic_potion 2.0 0.0 414.3sec 414.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
treants-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
moonkin_form

Database details

  • id:24858
  • cooldown name:buff_moonkin_form
  • tooltip:Arcane and Nature spell damage increased by $24905s3%. Immune to Polymorph effects. All damage reduced by $24905s1%. Spell haste of all party and raid members increased by $24907s1%
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
unaligned_eclipse_gain 0.3 158.8sec
wrong_eclipse_starfire 1.0 144.6sec
wrong_eclipse_wrath 3.4 98.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.95%
σ of the average dps 5.0595
2 * σ / μ 0.0397%
95% Confidence Intervall ( μ ± 2σ ) ( 25484.28 - 25504.52 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25479.22 - 25509.58 )
Sample Data
σ 505.9481
Minimum 23784.35
Maximum 27417.78
Spread ( max - min ) 3633.43
Range ( max - min ) / 2 1816.71
Range% 7.13
10th Percentile 24878.02
90th Percentile 26181.35
( 90th Percentile - 10th Percentile ) 1303.34
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1575
0.1 scale factor error with delta=300 2275
0.05 scale factor error with delta=300 9101
0.01 scale factor error with delta=300 227540
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 moonkin_form
4 snapshot_stats
5 volcanic_potion,if=!in_combat
6 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
7 faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
8 wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
9 berserking
A insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
B starsurge,if=buff.t11_4pc_caster.up
C starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
D wrath,if=buff.t11_4pc_caster.up
E wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
F wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
G typhoon,moving=1
H starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
I sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
J moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
K starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
L innervate,if=mana_pct<50
M treants,time>=5
N starfire,if=eclipse_dir=1&eclipse<80
O starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
P wrath,if=eclipse_dir=-1&eclipse>=-87
Q wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
R starfire,if=eclipse_dir=1
S wrath,if=eclipse_dir=-1
T starfire
U wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
V moonfire,moving=1
W sunfire,moving=1

Sample Sequence

013589AJKTTMNNKRBDKPPAKIPPPPPPKPPPOCACHJKNNNNNNQABDIPPPPPPAPPKPPJSCCCAHKNNJNNKNNADDDPPIKPPKAPPKPPPPBCHJNANNNNKNNJRADDDPKPPPPJAPPPPP9KSCCHMJNANKNNNNQDDDAIKPPPPPPPPPOABCHJNNNNNAKNNJBDDPPPAPPPPJKPPPPPCACBCHJNNNNNAKNQDDIPPPPAKPPPKPPJPOBCAHNNNJNNKNARQBDP9PPIPPMAPPKPPPPLCCCAHJKNNNNNNARJBDDPPPPPAPJKPPPKPOCCACHJNKNNNNNADDBDBIPPPPAPPPPKPCCCCAHJNKNNN6KNQADDIPPPPKPPPAPPPJSCBC9H

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 699 117 20
Agility 693 111 20
Stamina 7714 6088 5862
Intellect 6003 5283 4595
Spirit 1765 1765 1591
Health 147199 124505 0
Mana 107410 97600 0
Spell Power 9020 7480 2207
Spell Hit 16.93% 16.93% 143
Spell Crit 24.44% 18.33% 778
Spell Haste 23.87% 17.97% 2301
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 1797 469 0
Melee Hit 1.19% 1.19% 143
Melee Crit 18.94% 12.15% 778
Melee Haste 17.97% 17.97% 2301
Expertise 0.00 0.00 0
Armor 14998 10922 10922
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 7.80% 5.41% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 14.35% 14.35% 1138

Gear

Encoded
head stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2 security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
tabard empty

Talents

Balance Rank
Nature's Grace 3
Starlight Wrath 3
Nature's Majesty 2
Genesis 3
Moonglow 1
Balance of Power 2
Euphoria 2
Moonkin Form 1
Typhoon 1
Shooting Stars 2
Owlkin Frenzy 0
Gale Winds 2
Solar Beam 0
Dreamstate 2
Force of Nature 1
Sunfire 1
Earth and Moon 1
Fungal Growth 0
Lunar Shower 3
Starfall 1
Feral Rank
Feral Swiftness 0
Furor 0
Predatory Strikes 0
Infected Wounds 0
Fury Swipes 0
Primal Fury 0
Feral Aggression 0
King of the Jungle 0
Feral Charge 0
Stampede 0
Thick Hide 0
Leader of the Pack 0
Brutal Impact 0
Nurturing Instinct 0
Primal Madness 0
Survival Instincts 0
Endless Carnage 0
Natural Reaction 0
Blood in the Water 0
Rend and Tear 0
Pulverize 0
Berserk 0
Restoration Rank
Blessing of the Grove 2
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 2
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Balance_T11_372
origin="http://chardev.org/?profile=34049"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-332312211202021110310000000000000000000000220321000000000000000
glyphs=focus/rebirth/starfall/mark_of_the_wild/unburdened_rebirth/dash/starsurge/insect_swarm/moonfire
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/moonkin_form
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/faerie_fire,if=debuff.faerie_fire.stack<3&!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/wild_mushroom_detonate,if=buff.wild_mushroom.stack=3
actions+=/berserking
actions+=/insect_swarm,if=ticks_remain<2|(dot.insect_swarm.remains<4&buff.solar_eclipse.up&eclipse<15)
actions+=/starsurge,if=buff.t11_4pc_caster.up
actions+=/starfire,if=buff.t11_4pc_caster.up&buff.lunar_eclipse.up
actions+=/wrath,if=buff.t11_4pc_caster.up
actions+=/wild_mushroom_detonate,moving=1,if=buff.wild_mushroom.stack=3
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/typhoon,moving=1
actions+=/starfall,if=buff.lunar_eclipse.up&buff.t11_4pc_caster.down
actions+=/sunfire,if=(!ticking|ticks_remain<2|(dot.sunfire.remains<4&buff.solar_eclipse.up&eclipse<15))&!dot.moonfire.remains>0&buff.t11_4pc_caster.down
actions+=/moonfire,if=(!ticking|ticks_remain<2|(dot.moonfire.remains<4&buff.lunar_eclipse.up&eclipse>-20))&buff.t11_4pc_caster.down&!dot.sunfire.remains>0
actions+=/starsurge,if=!((eclipse<=-87&eclipse_dir=-1)|(eclipse>=80&eclipse_dir=1))
actions+=/innervate,if=mana_pct<50
actions+=/treants,time>=5
actions+=/starfire,if=eclipse_dir=1&eclipse<80
actions+=/starfire,prev=wrath,if=eclipse_dir=-1&eclipse<-87
actions+=/wrath,if=eclipse_dir=-1&eclipse>=-87
actions+=/wrath,prev=starfire,if=eclipse_dir=1&eclipse>=80
actions+=/starfire,if=eclipse_dir=1
actions+=/wrath,if=eclipse_dir=-1
actions+=/starfire
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<3
actions+=/moonfire,moving=1
actions+=/sunfire,moving=1
head=stormriders_cover,heroic=1,type=leather,ilevel=372,quality=epic,stats=1439armor_257crit_197haste_325int_578sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=stormriders_shoulderwraps,heroic=1,type=leather,ilevel=372,quality=epic,stats=1328armor_171haste_266int_191mastery_429sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=50int_25haste
chest=scorched_wormling_vest,heroic=1,type=leather,ilevel=372,quality=epic,stats=1771armor_345int_257mastery_217spi_578sta,reforge=mastery_haste,gems=67int_67int,enchant=20all
waist=belt_of_the_nightmare,heroic=1,type=leather,ilevel=372,quality=epic,stats=996armor_191crit_266int_171spi_429sta,reforge=crit_haste,gems=40int_40int
legs=stormriders_leggings,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_257haste_345int_217spi_578sta,gems=40int_20int_20spi_20int,enchant=95int_55spi
feet=nightmare_riders_boots,heroic=1,type=leather,ilevel=379,quality=epic,stats=1257armor_266int_204mastery_164spi_458sta,reforge=mastery_haste,gems=20int_20spi_40int_20int,enchant=35mastery
wrists=manacles_of_the_sleeping_beast,heroic=1,type=leather,ilevel=372,quality=epic,stats=775armor_215int_143mastery_143spi_322sta,reforge=mastery_haste,enchant=50int
hands=stormriders_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=1107armor_191crit_171haste_266int_429sta,reforge=crit_spi,gems=67int_10crit,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
finger2=security_measure_alpha,heroic=1,ilevel=372,quality=epic,stats=143crit_215int_143spi_322sta,reforge=crit_haste
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_spi,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5862
# gear_intellect=4595
# gear_spirit=1591
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=778
# gear_haste_rating=2301
# gear_mastery_rating=1138
# gear_armor=10922
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Druid_Feral_T11_372 : 24988dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24987.6 10.46 / 0.04% 1612.7 15.5 15.3 energy 46.97% 34.3
Origin http://chardev.org/?profile=35492
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:65855|33175|32133|21183|14000|4819&chds=0,131710&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++65855++rake,C55D54,0,0,15|t++33175++ravage,C79C6E,1,0,15|t++32133++ferocious_bite,C79C6E,2,0,15|t++21183++shred,C79C6E,3,0,15|t++14000++mangle_cat,C79C6E,4,0,15|t++4819++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,20,19,4,3,3,0&chds=0,100&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=rip|shred|rake|cat_melee|fury_swipes|mangle_cat|ferocious_bite|ravage&chtt=Druid_Feral_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:puiku47700zzvsqoonmljihgedbZXWXemolhdaYWVUUUUTTSSTTSTTTTTTWcggecaXWVVUUUUTTTSSSSTTTTTUYdfgecaYXWVUUUUUTTTTSSSSSTTUYceedbZXWVUUTTTTTTTTTTTSSSTVZcddcbZXWVUTTTTTTTTUUTUUTTUWadeedcaZXWVUUTTTTTTTTTTTTTUWZcddddddeedcbZYWVTSSRRRSSTUWYabcbaZYWWVVUUUUTTTTTTTTTUVXZccccbaYXWVUUUUUUTTTTSSTTUVXZabbbZZXWVVUUTTTTTTTTTSSTTVXZabbaaZYWVVUUUTTTTTTTTTTTUVXZbbbbaZYWWVUUTTTTTTTTTTTTUVXYaaaaZYXWVVUUTTTSSSSSTTTTUVXYaabbccccbbaYXVUTSRRRRRRSTVWYZZZZYXXWVUUTUTTTTSSSSSTTUWXYZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=70&chtt=Druid_Feral_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:qsuxyyyzz00124578765320zyxwwwvutsrqpnnmmllkkjjihgggggghhhiiiijjjkjjjjjihhhhggghhhiiiiiiijjjjkkkkkjiihgggggghhiiiiiiiiiiiiijjjiihggfffffgghhhhhhhhhhhhhhhiihhhggggggghiijjjkkkkkjjjjjjjjjiihhhggggghhiijjkllmmmnnnooooonnnnnnmmmlllllkkkkkkjjjiiihhhhhhhhiiiiiiiiijjjjjjjjiihhggggghhhhhiiihhiiiiiiiiiihhgffffffgggghhhhhhhhhhhiiiihhhhggggghhhiiiijjjjjijjjiiiiihhhggggggggghhhhhhhhhhhhhhgggggggggggghhhijjklmmnnooooooooooooonnnmmllkkjjjjiiiihhgggfffffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24988|max=41837&chxp=1,1,60,100&chtt=Druid_Feral_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,2,0,3,2,9,21,13,31,49,70,84,97,145,186,226,286,323,377,410,485,593,529,628,590,591,555,573,492,423,419,335,326,245,207,145,138,118,61,60,44,38,20,17,16,7,3,3,1,2&chds=0,628&chbh=5&chxt=x&chxl=0:|min=23080|avg=24988|max=26949&chxp=0,1,49,100&chtt=Druid_Feral_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372 24988
berserk 0 0.0% 2.8 195.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.76 2.76 0.00 0.00 1.0164 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Mangle (Bear) can hit up to $58923s1 targets with no cooldown. Reduces the energy cost of your Cat Form abilities by $s1%.
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4816 19.3% 547.4 0.83sec 3978 4819 2922 6049 7505 49.5% 10.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.41 547.41 0.00 0.00 0.8255 0.0000 2177526
Direct Results Count Pct Average Min Max Total Damage
hit 85.8 15.67% 2921.78 1848 3643 250576
crit 270.8 49.46% 6049.10 3807 7505 1637856
glance 131.4 24.01% 2199.29 1386 2732 289094
dodge 35.5 6.49% 0.00 0 0 0
miss 23.9 4.37% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 667 2.7% 9.2 51.34sec 32734 32133 20010 42247 73912 67.0% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.21 9.21 0.00 0.00 1.0187 0.0000 301551
Direct Results Count Pct Average Min Max Total Damage
hit 2.0 22.06% 20010.12 2964 35880 40667
crit 6.2 67.03% 42247.15 6107 73912 260885
dodge 0.6 6.59% 0.00 0 0 0
miss 0.4 4.32% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 950 3.8% 51.7 8.71sec 8313 0 6108 12629 15510 44.0% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.66 51.66 0.00 0.00 0.0000 0.0000 429470
Direct Results Count Pct Average Min Max Total Damage
hit 23.3 45.10% 6107.56 5729 7529 142320
crit 22.7 44.01% 12629.41 11801 15510 287150
dodge 3.4 6.50% 0.00 0 0 0
miss 2.3 4.39% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s2% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 706 2.8% 22.2 20.68sec 14358 14000 10519 21707 25644 44.6% 11.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.25 22.25 0.00 0.00 1.0256 0.0000 319404
Direct Results Count Pct Average Min Max Total Damage
hit 9.9 44.43% 10518.69 9610 12449 103961
crit 9.9 44.62% 21707.25 19797 25644 215442
dodge 1.5 6.62% 0.00 0 0 0
miss 1.0 4.33% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 5000 20.0% 33.5 13.51sec 67553 65855 1884 3896 4670 44.0% 10.9% 0.0% 0.0% 146 9728 20129 49.5% 0.0% 96.1%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.47 33.47 146.18 146.18 1.0258 2.9727 2260792
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 45.08% 1883.84 1778 2267 28420
crit 14.7 44.02% 3896.38 3663 4670 57408
dodge 2.2 6.53% 0.00 0 0 0
miss 1.5 4.37% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.8 50.48% 9728.26 9157 12018 717908
crit 72.4 49.52% 20128.54 18864 24756 1457057

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 74 0.3% 1.0 0.00sec 33472 33175 23001 47406 47613 53.3% 11.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0090 0.0000 33472
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 35.65% 23000.75 20098 23113 8200
crit 0.5 53.31% 47405.87 41403 47613 25272
dodge 0.1 6.89% 0.00 0 0 0
miss 0.0 4.15% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6425 25.7% 19.7 22.66sec 147100 143619 0 0 0 0.0% 10.9% 0.0% 0.0% 199 9506 19667 49.8% 0.0% 88.2%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.75 19.75 199.49 199.49 1.0242 2.0000 2905025
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 89.11% 0.00 0 0 0
dodge 1.3 6.51% 0.00 0 0 0
miss 0.9 4.37% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.2 50.24% 9506.14 8719 11527 952698
crit 99.3 49.76% 19667.32 17962 23746 1952327

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.99 13.99 0.00 0.00 1.0256 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6348 25.4% 132.6 3.35sec 21652 21183 15896 32867 39324 44.1% 10.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.55 132.55 0.00 0.00 1.0222 0.0000 2870060
Direct Results Count Pct Average Min Max Total Damage
hit 59.7 45.04% 15895.91 15022 19089 948943
crit 58.5 44.10% 32867.09 30946 39324 1921117
dodge 8.6 6.51% 0.00 0 0 0
miss 5.8 4.36% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.49 16.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372
feral_charge_cat energy 0.1% 0.0 10
ferocious_bite energy 5.3% 807.1 41
mangle_cat energy 10.2% 446.4 32
rake energy 14.3% 2255.3 30
rip energy 7.5% 5515.8 27
savage_roar energy 4.8% 0.0 24
shred energy 57.7% 710.3 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 88.8 569.4 6.4 0.0%
energy_regen energy 1808.8 4982.2 2.8 0.1%
omen_of_clarity none 28.3 1083.8 38.3 0.0%
tigers_fury energy 16.5 989.4 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.7sec 195.7sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.3 137.1 11.4sec 2.5sec 78% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 56.1sec 56.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 28.3 0.3 15.6sec 15.4sec 3% 4%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 81.4sec 81.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.8sec 23.8sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 80.6sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:32.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee 1.7 18.1 163.8sec 23.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 28.0sec 28.0sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 413.9sec 413.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.9 7.9sec
fury_swipes 51.7 8.7sec
primal_fury 83.6 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.91%
σ of the average dps 5.2317
2 * σ / μ 0.0419%
95% Confidence Intervall ( μ ± 2σ ) ( 24977.14 - 24998.07 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24971.91 - 25003.30 )
Sample Data
σ 523.1710
Minimum 23080.03
Maximum 26948.52
Spread ( max - min ) 3868.49
Range ( max - min ) / 2 1934.25
Range% 7.74
10th Percentile 24334.75
90th Percentile 25672.77
( 90th Percentile - 10th Percentile ) 1338.02
Approx. Iterations needed for
1% dps error 17
0.1% dps error 1753
0.1 scale factor error with delta=300 2432
0.05 scale factor error with delta=300 9731
0.01 scale factor error with delta=300 243295
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBB9IIJMRSSSFSPSSSKSSSSSSSSI9BBBBBJMSQQKISSSS9PSBBBNKSSSS9ISKLPSSBSKKIIS9MSSSKSSBNSSKIS9LSPSKKBKISSLM9KSSSSBIKSSSS9SKMSFSSSBISSKSSPS9SSSKISBMSKSSS9SIISSKSSPBSSKMSS9SISSKSBSSLSIIKK9SSMSSBKISSS9KSSSMLSBIKKSSLSS9KSSIIBSKMSQS9SIKSFSSBHSSSKHSSGS9SMKSBIISKSN9SSSKIBBBSHKS9SSSISSKHHLMBLSAKG9SSSISKMBSSSHKS9SG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7051 5457 5366
Stamina 7698 6073 5847
Intellect 191 182 20
Spirit 192 192 20
Health 146975 124295 0
Mana 24400 24245 0
Spell Power 199 172 0
Spell Hit 4.26% 4.26% 436
Spell Crit 20.54% 15.53% 2222
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 24067 829 190
Melee Hit 3.63% 3.63% 436
Melee Crit 51.57% 37.66% 2222
Melee Haste 3.97% 3.97% 508
Expertise 0.00 0.00 0
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.65% 24.31% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.98% 19.98% 2148

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372
origin="http://chardev.org/?profile=35492"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=hit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_crit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=40agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,gems=40agi_40agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_crit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=hit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_mastery,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5366
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=436
# gear_crit_rating=2222
# gear_haste_rating=508
# gear_mastery_rating=2148
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Druid_Feral_T11_372_hitcap : 24950dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
24950.2 10.21 / 0.04% 1699.7 14.7 14.5 energy 48.85% 33.2
Origin http://chardev.org/?profile=35430
Talents http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
Glyphs
  • rip
  • shred
  • tigers_fury

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:68739|35157|33356|22034|14542|4883&chds=0,137479&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++68739++rake,C55D54,0,0,15|t++35157++ravage,C79C6E,1,0,15|t++33356++ferocious_bite,C79C6E,2,0,15|t++22034++shred,C79C6E,3,0,15|t++14542++mangle_cat,C79C6E,4,0,15|t++4883++cat_melee,C79C6E,5,0,15&chtt=Druid_Feral_T11_372_hitcap+Damage+Per+Execute+Time&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:26,25,20,20,4,3,3,0&chds=0,100&chco=C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=shred|rip|cat_melee|rake|fury_swipes|ferocious_bite|mangle_cat|ravage&chtt=Druid_Feral_T11_372_hitcap+Damage+Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:nqdhv584utttpligfedbaZYWWVVUSTVenmicYWUTTSTTSSRRRSSRRSSSSRVdgdaYWUUTTSTTSSSSQRRRSSSSSTZefdaYWVUTTTSSSSSSSSRRRRSSSUZddbZXWUSSSSSSSSSSSSSSRRRRSVZccbZXWVTSSRRRSSSSSSSSTSSSTXbddcaYWVUTTSSSRSSSSSSSSSSSUXaccbaabccbaYWVTSRQPPPPQRRSUWZaaZYXVVUTTTTSSSSRRSSSSSSTVYabbaZXWVUTTTTSSSSSRRRRRSSTVYZaaZYWVUTSSSSSSSSSSSSRRRSTVYZaaZYXVUTSSSSSSSSSSSSSSSSUWYZaaZYXVUUTSSSRRSRSSSSSSSTUWYZZZYXWVUTTSSSRRRRRRRRSSSTUWYZZZZZaaaZYWVUSRQPPPPPQQRSUWXYYYXWVUTTTSSSSSSSRRRRRRSTVWXYY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=72&chtt=Druid_Feral_T11_372_hitcap+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwyzzzzz1023457765321zywwvvutsrqponmmlkkkjjihggffgfgggghhhiiijjjjjiiihggggffgghhhhhhhhiiijjjjjjjihgffffffgghhhhhhhhhhhhiiiiihhgfeeeeeffggghhhhgggggghhhhhgggfffffgghhiijjjjjjjjjiijjiihhgggfffffgghhijjkklllmmmnnnnnnmmmmmlllkkkkkkjjjjjjiiihhhggggghhhhhhhhiiiiiiijjiiihggfffffgghhhhhhhhhhhhhhhhhhggffeeeeeffgggggggggggghhhhhhgggfffffgghhhiiiiiiiiiiiiihhhgggfffffffggggggggggggggggfffffffffffggghiijkllmnnnoooooonnnnnnmmllkkjjjiiiihhhhggfffeeefffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=24950|max=42622&chxp=1,1,59,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,0,1,4,3,4,9,16,26,30,45,75,101,132,159,208,280,313,361,410,448,493,521,548,582,579,573,515,512,501,472,377,361,255,248,180,152,152,94,71,43,46,22,32,19,10,8,3,1,2&chds=0,582&chbh=5&chxt=x&chxl=0:|min=23071|avg=24950|max=26786&chxp=0,1,51,100&chtt=Druid_Feral_T11_372_hitcap+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Druid_Feral_T11_372_hitcap 24950
berserk 0 0.0% 2.8 195.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.77 2.77 0.00 0.00 1.0172 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.8 100.00% 0.00 0 0 0

Action details: berserk

Static Values
  • id:50334
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Mangle (Bear) can hit up to $58923s1 targets with no cooldown. Reduces the energy cost of your Cat Form abilities by $s1%.
  • description:Your Lacerate periodic damage has a $s3% chance to refresh the cooldown of your Mangle (Bear) ability and make it cost no rage. In addition, when activated this ability causes your Mangle (Bear) ability to hit up to $58923s1 targets and have no cooldown, and reduces the energy cost of all your Cat Form abilities by $s1%. Lasts $d. You cannot use Tiger's Fury while Berserk is active.
cat_melee 4880 19.6% 547.5 0.83sec 4030 4883 2920 6039 7485 44.8% 3.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
547.49 547.49 0.00 0.00 0.8254 0.0000 2206469
Direct Results Count Pct Average Min Max Total Damage
hit 149.4 27.29% 2919.93 1843 3633 436224
crit 245.4 44.82% 6038.86 3796 7485 1481775
glance 131.4 24.00% 2195.39 1382 2725 288470
dodge 21.3 3.89% 0.00 0 0 0

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
ferocious_bite 681 2.7% 9.1 53.28sec 34004 33356 19812 41798 73687 68.0% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.06 9.06 0.00 0.00 1.0194 0.0000 308037
Direct Results Count Pct Average Min Max Total Damage
hit 2.5 28.10% 19811.89 2955 35770 50433
crit 6.2 68.03% 41798.50 6087 73687 257604
dodge 0.4 3.87% 0.00 0 0 0

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[.][ and consumes up to $m2 additional energy to increase damage by up to 100%.] Damage is increased by your attack power. 1 point : ${$m1+$b1*1*$+0.109*$AP*$}-${$M1+$b1*1*$+0.109*$AP*$} damage 2 points: ${$m1+$b1*2*$+0.218*$AP*$}-${$M1+$b1*2*$+0.218*$AP*$} damage 3 points: ${$m1+$b1*3*$+0.327*$AP*$}-${$M1+$b1*3*$+0.327*$AP*$} damage 4 points: ${$m1+$b1*4*$+0.436*$AP*$}-${$M1+$b1*4*$+0.436*$AP*$} damage 5 points: ${$m1+$b1*5*$+0.545*$AP*$}-${$M1+$b1*5*$+0.545*$AP*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.545000
  • base_dd_min:206.98
  • base_dd_max:450.11
fury_swipes 1043 4.2% 54.4 8.27sec 8666 0 6093 12595 15468 43.2% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fury_swipes

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.43 54.43 0.00 0.00 0.0000 0.0000 471651
Direct Results Count Pct Average Min Max Total Damage
hit 28.7 52.82% 6093.37 5712 7509 175174
crit 23.5 43.25% 12595.04 11766 15468 296477
dodge 2.1 3.93% 0.00 0 0 0

Action details: fury_swipes

Static Values
  • id:80861
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you auto-attack while in Cat form or Bear form, you have a chance to cause a Fury Swipe dealing $80861s2% weapon damage. This effect cannot occur more than once every 3 sec.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.10
mangle_cat 671 2.7% 20.3 22.76sec 14962 14542 10487 21641 25582 43.8% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mangle_cat

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.27 20.27 0.00 0.00 1.0288 0.0000 303214
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 52.24% 10487.18 9586 12419 111031
crit 8.9 43.82% 21641.04 19746 25582 192183
dodge 0.8 3.94% 0.00 0 0 0

Action details: mangle_cat

Static Values
  • id:33876
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:All bleed effects cause $s2% additional damage.
  • description:Mangle the target for $m3% normal damage plus ${$m1*$m3/100} and causes the target to take $s2% additional damage from bleed effects for $d. Awards $34071s1 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:315.72
  • base_dd_max:315.72
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.60
rake 4870 19.5% 31.2 14.57sec 70661 68739 1888 3905 4676 43.2% 3.8% 0.0% 0.0% 147 9741 20158 44.9% 0.0% 96.6%

Stats details: rake

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.16 31.16 146.84 146.84 1.0280 2.9747 2201711
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 52.96% 1887.99 1780 2270 31155
crit 13.5 43.20% 3905.27 3667 4676 52563
dodge 1.2 3.84% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 80.8 55.05% 9741.41 9160 12026 787480
crit 66.0 44.95% 20158.06 18870 24774 1330513

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for ${$AP*0.0207+$m1} bleed damage and an additional ${$m2*3+$AP*0.378} bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.020700
  • base_dd_min:273.30
  • base_dd_max:273.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.126000
  • base_td:557.44
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ravage 78 0.3% 1.0 0.00sec 35457 35157 23026 47432 47499 54.4% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ravage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0085 0.0000 35457
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 42.03% 23026.34 20050 23058 9678
crit 0.5 54.35% 47431.86 41304 47499 25779
dodge 0.0 3.62% 0.00 0 0 0

Action details: ravage

Static Values
  • id:6785
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ravage the target, causing $m2% damage plus ${$m1*$m2/100} to the target. Must be prowling and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:8.50
rip 6257 25.1% 18.4 24.45sec 154037 150126 0 0 0 0.0% 4.0% 0.0% 0.0% 200 9530 19721 45.3% 0.0% 88.5%

Stats details: rip

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.36 18.36 199.95 199.95 1.0261 2.0000 2828728
Direct Results Count Pct Average Min Max Total Damage
hit 17.6 96.03% 0.00 0 0 0
dodge 0.7 3.97% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 109.4 54.69% 9529.83 8726 11539 1042129
crit 90.6 45.31% 19721.44 17976 23771 1786599

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes bleed damage over time. Damage increases per combo point and by your attack power: 1 point: ${($m1+$b1*1+0.0207*$AP)*8} damage over $d. 2 points: ${($m1+$b1*2+0.0414*$AP)*8} damage over $d. 3 points: ${($m1+$b1*3+0.0621*$AP)*8} damage over $d. 4 points: ${($m1+$b1*4+0.0828*$AP)*8} damage over $d. 5 points: ${($m1+$b1*5+0.1035*$AP)*8} damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.103500
  • base_td:860.93
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
savage_roar 0 0.0% 14.0 33.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.00 14.00 0.00 0.00 1.0259 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.0 100.00% 0.00 0 0 0

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • tree:feral
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Autoattack damage done increased by $w2%.
  • description:Finishing move that consumes combo points on any nearby target to increase autoattack damage done by $62071s2%. Only useable while in Cat Form. Lasts longer per combo point: 1 point : ${$d+5} seconds 2 points: ${$d+10} seconds 3 points: ${$d+15} seconds 4 points: ${$d+20} seconds 5 points: ${$d+25} seconds
shred 6470 25.9% 129.7 3.44sec 22549 22034 15869 32824 39230 43.1% 3.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
129.72 129.72 0.00 0.00 1.0234 0.0000 2925010
Direct Results Count Pct Average Min Max Total Damage
hit 68.8 53.01% 15868.98 14983 19043 1091276
crit 55.9 43.07% 32823.79 30865 39230 1833734
dodge 5.1 3.92% 0.00 0 0 0

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • tree:feral
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus ${$m1*$m3/100} to the target. Must be behind the target. Awards $s2 combo $lpoint:points;. Effects which increase Bleed damage also increase Shred damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:330.52
  • base_dd_max:330.52
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.50
tigers_fury 0 0.0% 16.5 27.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.55 16.55 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.5 100.00% 0.00 0 0 0

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:energy
  • tree:feral
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:27.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d.

Resources

Resource Usage Type Res% DPR RPE
Druid_Feral_T11_372_hitcap
feral_charge_cat energy 0.2% 0.0 10
ferocious_bite energy 5.6% 831.2 41
mangle_cat energy 9.8% 467.2 32
rake energy 13.9% 2390.6 30
rip energy 7.3% 5827.4 26
savage_roar energy 5.1% 0.0 24
shred energy 58.2% 757.0 30
Resource Gains Type Count energy Average Overflow
energy_refund energy 31.7 192.7 6.1 0.0%
energy_regen energy 1808.8 4983.9 2.8 0.0%
omen_of_clarity none 30.5 1169.4 38.4 0.0%
tigers_fury energy 16.5 993.0 60.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.8 0.0 195.4sec 195.4sec 9% 9%

Database details

  • id:
  • cooldown name:buff_berserk
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
combo_points 40.8 138.8 11.2sec 2.5sec 79% 76%

Database details

  • id:
  • cooldown name:buff_combo_points
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.6sec 55.6sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
omen_of_clarity 30.5 0.4 14.5sec 14.3sec 3% 5%

Database details

  • id:
  • cooldown name:buff_omen_of_clarity
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.83%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
primal_madness_cat 19.3 0.0 23.7sec 23.7sec 31% 31%

Database details

  • id:
  • cooldown name:buff_primal_madness_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
savage_roar 5.9 8.1 79.9sec 33.1sec 97% 97%

Database details

  • id:52610
  • cooldown name:buff_savage_roar
  • tooltip:Autoattack damage done increased by $w2%.
  • max_stacks:1
  • duration:42.00
  • cooldown:0.00
  • default_chance:100.00%
stampede_cat 1.0 0.0 0.0sec 0.0sec 1% 0%

Database details

  • id:
  • cooldown name:buff_stampede_cat
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
t11_4pc_melee 1.5 18.0 165.8sec 23.7sec 100% 100%

Database details

  • id:
  • cooldown name:buff_t11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
tigers_fury 16.5 0.0 27.9sec 27.9sec 22% 26%

Database details

  • id:
  • cooldown name:buff_tigers_fury
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 413.9sec 413.9sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat_form

Database details

  • id:768
  • cooldown name:buff_cat_form
  • tooltip:Immunity to Polymorph effects. Causes agility to increase attack power.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points_wasted 74.1 7.7sec
fury_swipes 54.4 8.3sec
primal_fury 78.7 5.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.52%
σ of the average dps 5.1073
2 * σ / μ 0.0409%
95% Confidence Intervall ( μ ± 2σ ) ( 24940.03 - 24960.46 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 24934.93 - 24965.57 )
Sample Data
σ 510.7348
Minimum 23070.87
Maximum 26786.11
Spread ( max - min ) 3715.24
Range ( max - min ) / 2 1857.62
Range% 7.45
10th Percentile 24308.04
90th Percentile 25621.96
( 90th Percentile - 10th Percentile ) 1313.93
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1676
0.1 scale factor error with delta=300 2318
0.05 scale factor error with delta=300 9274
0.01 scale factor error with delta=300 231866
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 mark_of_the_wild
3 cat_form
4 snapshot_stats
5 tolvir_potion,if=!in_combat
6 feral_charge_cat,if=!in_combat
7 auto_attack
8 skull_bash_cat
9 tigers_fury,if=energy<=26
A tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
B mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
C faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
D mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
E ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
F berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
G ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
H ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
I rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
J rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier<multiplier)
K rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
L shred,if=buff.omen_of_clarity.react
M savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
N savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
O ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
P ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
Q shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
R ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
S shred

Sample Sequence

013567BBBBI9JMRSSSFPPSSSKSSSSSSSIB9KMLSSPSSKSSSISBS9KSSMSSKISSSBP9SKSSSISKMSB9SSSLKSISSKSSSMB9SSSIIKSSSKBBLS9ISSSMKSSLIB9JSSSFNSSSKSLSISSBLS9KSSSSSIKSLMBS9KSSILSSKSSBS9IKKSMSSSKSIB9BBNKSSSSSIKS9SBSNKSLSIKSSS9PBSSSKSSMLSSKBI9SSSHFSSSKHSSSHSB9KISMSSSHKSGS9BIKMSSSSKNLSB9SISKSHSSSAHK9BSSSMKSSSIK9BO

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 701 119 20
Agility 7018 5427 5336
Stamina 7698 6073 5847
Intellect 191 182 20
Spirit 192 192 20
Health 146975 124295 0
Mana 24400 24245 0
Spell Power 199 172 0
Spell Hit 9.38% 9.38% 961
Spell Crit 16.00% 10.99% 1408
Spell Haste 9.17% 3.97% 508
Spell Penetration 0 0 0
Mana Per 5 931 931 0
Attack Power 23967 829 190
Melee Hit 8.00% 8.00% 961
Melee Crit 46.93% 33.03% 1408
Melee Haste 3.97% 3.97% 508
Expertise 10.42 10.42 313
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 33.56% 24.22% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 20.18% 20.18% 2184

Gear

Encoded
head stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
tabard empty

Talents

Balance Rank
Nature's Grace 0
Starlight Wrath 0
Nature's Majesty 0
Genesis 0
Moonglow 0
Balance of Power 0
Euphoria 0
Moonkin Form 0
Typhoon 0
Shooting Stars 0
Owlkin Frenzy 0
Gale Winds 0
Solar Beam 0
Dreamstate 0
Force of Nature 0
Sunfire 0
Earth and Moon 0
Fungal Growth 0
Lunar Shower 0
Starfall 0
Feral Rank
Feral Swiftness 2
Furor 3
Predatory Strikes 2
Infected Wounds 0
Fury Swipes 3
Primal Fury 2
Feral Aggression 2
King of the Jungle 3
Feral Charge 1
Stampede 2
Thick Hide 0
Leader of the Pack 1
Brutal Impact 1
Nurturing Instinct 2
Primal Madness 2
Survival Instincts 1
Endless Carnage 2
Natural Reaction 0
Blood in the Water 2
Rend and Tear 3
Pulverize 0
Berserk 1
Restoration Rank
Blessing of the Grove 0
Natural Shapeshifter 2
Naturalist 0
Heart of the Wild 3
Perseverance 0
Master Shapeshifter 1
Improved Rejuvenation 0
Living Seed 0
Revitalize 0
Nature's Swiftness 0
Fury of Stormrage 0
Nature's Bounty 0
Empowered Touch 0
Malfurion's Gift 0
Efflorescence 0
Wild Growth 0
Nature's Cure 0
Nature's Ward 0
Gift of the Earthmother 0
Swift Rejuvenation 0
Tree of Life 0

Profile

#!./simc

druid=Druid_Feral_T11_372_hitcap
origin="http://chardev.org/?profile=35430"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#druid-000000000000000000002320322312011221202301020301000000000000000
glyphs=rip/shred/tigers_fury
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/mark_of_the_wild
actions+=/cat_form
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat
actions+=/feral_charge_cat,if=!in_combat
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/tigers_fury,if=energy<=26
actions+=/tolvir_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mangle_cat,if=set_bonus.tier11_4pc_melee&(buff.t11_4pc_melee.stack<3|buff.t11_4pc_melee.remains<3)
actions+=/faerie_fire_feral,if=debuff.faerie_fire.stack<3|!(debuff.sunder_armor.up|debuff.expose_armor.up)
actions+=/mangle_cat,if=debuff.mangle.remains<=2&(!debuff.mangle.up|debuff.mangle.remains>=0.0)
actions+=/ravage,if=buff.stampede_cat.up&buff.stampede_cat.remains<=1
actions+=/berserk,if=time_to_max_energy>=2.0&!buff.tigers_fury.up&cooldown.tigers_fury.remains>15
actions+=/ferocious_bite,if=buff.combo_points.stack>=1&dot.rip.ticking&dot.rip.remains<=1&target.health_pct<=25
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.ticking&target.health_pct<=25
actions+=/rip,if=buff.combo_points.stack>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/rake,if=target.time_to_die>=8.5&buff.tigers_fury.up&dot.rake.remains<9.0&(!dot.rake.ticking|dot.rake.multiplier actions+=/rake,if=target.time_to_die>=dot.rake.remains&dot.rake.remains<3.0&(buff.berserk.up|energy>=71|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/savage_roar,if=buff.combo_points.stack>=1&buff.savage_roar.remains<=1
actions+=/savage_roar,if=target.time_to_die>=9&buff.combo_points.stack>=5&dot.rip.ticking&dot.rip.remains<=12&@(dot.rip.remains-buff.savage_roar.remains)<=3
actions+=/ferocious_bite,if=(target.time_to_die<=4&buff.combo_points.stack>=5)|target.time_to_die<=1
actions+=/ferocious_bite,if=buff.combo_points.stack>=5&dot.rip.remains>=14.0&buff.savage_roar.remains>=10.0
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4&target.health_pct>25
actions+=/ravage,if=buff.stampede_cat.up&!buff.omen_of_clarity.react&buff.tigers_fury.up
actions+=/shred
head=stormriders_headpiece,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_hit
shoulders=stormriders_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=haste_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=sark_of_the_unwatched,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_227crit_247mastery_578sta,reforge=crit_exp,gems=40agi_20agi_20mastery_20mastery,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=stormriders_legguards,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1550armor_217crit_257mastery_578sta,reforge=crit_hit,gems=20agi_20mastery_20agi_20hit_20agi,enchant=190ap_55crit
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=haste_hit,gems=40agi,enchant=35mastery
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=stormriders_grips,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_windstorm,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143mastery,reforge=crit_exp,suffix=137
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=crit_hit,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=haste_exp,gems=40agi
# Gear Summary # gear_strength=20
# gear_agility=5336
# gear_stamina=5847
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=313
# gear_hit_rating=961
# gear_crit_rating=1408
# gear_haste_rating=508
# gear_mastery_rating=2184
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max

Hunter_BM_T11_372 : 28001dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28001.0 8.31 / 0.03% 2638.5 10.6 10.5 focus 0.00% 60.8
Origin http://chardev.org/?profile=34113
Talents http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
Glyphs
  • bestial_wrath
  • kill_command
  • arcane_shot
  • kill_shot

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:31827|26116|16084|10222|7181|4309|2896&chds=0,63655&chco=C79C6E,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E&chm=t++31827++kill_command,C79C6E,0,0,15|t++26116++kill_shot,C79C6E,1,0,15|t++16084++arcane_shot,69CCF0,2,0,15|t++10222++cobra_shot,336600,3,0,15|t++7181++claw,C79C6E,4,0,15|t++4309++ranged,C79C6E,5,0,15|t++2896++melee,C79C6E,6,0,15&chtt=Hunter_BM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:19,18,17,15,13,10,4,3&chds=0,100&chco=69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=arcane_shot|cobra_shot|kill_command|ranged|claw|melee|serpent_sting|kill_shot&chtt=Hunter_BM_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x832zwwqmlpy1sqz233tqx123vrx123wqw023xrv024yrv024zsv024zssw022ytsw122ztrrnjhcXWVYgggntx1zuuw021xuux120xtuz110vswz12yttwz22xvtw121zusx012yttxz20vsokieZXXclswusuz111vswz02zttxz21xuux110xtvz110vswz12zttwz21yutw011ztrrokidYXWXddfmrvzzvvwz21zwuv0110vtwz01yuvxz20wvvx11zxvvz00zvuxz01yuvxz10wtpljgbZYbjptusuy001xuwy020wvwy11zxvwz000xuxz02zwwxz11yxwy220zyz2200yyzyvtqmkhefgjptvyxwyyz10xyyy11zyxxz000yxzz010yyzz10zzyy00z0zyz0z0zyzzz10yxurqokjiimqsvwwyzz0zyzzz1&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=92&chtt=Hunter_BM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:62375543353302121zvvuuvupqqrqpmmnppommnooommnppommmmnnlllllmllmmmonnnoopponnnnopnmmmmmlkkjjjkkjjkkkkkkkkkkkjjjjkkkkkkkkkkkkkkkkkkkkllmmmmnooonnnnnonmmnnnnlkkkkkjiijjkkkkkkkllkkkkkllkkkkklkkkkkjkjjjjjjjjjkklmmmnnnoonmmmnnnnmmlllkkjiiijjjjkkkkkklllllllllllllkllllkkkkkkkkjjjkklllmnnooooooooonnnoonmlllkkkjjjjjkjkjkkkkkkkkkkkkkklllllllmmmnnnnoopppqqrsssttuuutssssssrrrqqpoonnmmmmmmmmmmmmmmmllllmmmmmmmmmmmmmmmnnnnnnnoppqrrsttuvvvvvvvvvvvuutssrqqqoopoopoo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=28001|max=42420&chxp=1,1,66,100&chtt=Hunter_BM_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,4,6,2,13,27,40,48,83,99,131,189,219,249,318,354,411,475,490,590,599,616,613,603,517,517,492,439,397,308,263,209,178,119,109,86,57,39,29,28,9,6,5,2,5,0,0,0,3&chds=0,616&chbh=5&chxt=x&chxl=0:|min=26559|avg=28001|max=29708&chxp=0,1,46,100&chtt=Hunter_BM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_BM_T11_372 28001
arcane_shot 5243 18.7% 146.1 3.08sec 16217 16084 11693 24244 31559 36.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.13 145.86 0.00 0.00 1.0083 0.0000 2369822
Direct Results Count Pct Average Min Max Total Damage
hit 92.9 63.71% 11692.87 10837 15320 1086631
crit 52.9 36.29% 24243.65 22323 31559 1283192

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 70.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.93 6.93 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:70.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped unless killed.
cobra_shot 4917 17.6% 178.5 2.47sec 12449 10222 9031 18654 23032 35.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.50 178.16 0.00 0.00 1.2179 0.0000 2222150
Direct Results Count Pct Average Min Max Total Damage
hit 114.4 64.24% 9031.49 8766 11500 1033638
crit 63.7 35.76% 18654.26 18059 23032 1188511

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
fervor 0 0.0% 1.7 156.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fervor

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.70 1.70 0.00 0.00 1.0053 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.7 100.00% 0.00 0 0 0

Action details: fervor

Static Values
  • id:82726
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly restores $s1 Focus to you and your pet.
focus_fire 0 0.0% 25.6 17.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.64 25.64 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 25.6 100.00% 0.00 0 0 0

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy Effect stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy Effect stack consumed. Lasts for $d.
kill_command 4817 17.2% 68.0 6.68sec 32009 31827 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.02 68.02 0.00 0.00 1.0057 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 68.0 100.00% 0.00 0 0 0

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • tree:beast_mastery
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:37.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Give the command to kill, causing your pet to instantly inflict $ damage to its target. Your Pet's happiness increases the damage done. The pet must be in combat and within 5 yards of the target to Kill Command.
kill_shot 952 3.4% 16.4 5.42sec 26274 26116 19057 39381 50516 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.37 16.23 0.00 0.00 1.0061 0.0000 430098
Direct Results Count Pct Average Min Max Total Damage
hit 10.3 63.35% 19057.02 17624 24522 195885
crit 5.9 36.65% 39380.74 36305 50516 234213

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 4303 15.4% 237.7 1.91sec 8183 4309 5904 12228 16284 36.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
237.66 237.66 0.00 0.00 1.8990 0.0000 1944726
Direct Results Count Pct Average Min Max Total Damage
hit 152.0 63.97% 5904.46 5607 7905 897656
crit 85.6 36.03% 12228.17 11551 16284 1047070

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1182 4.2% 1.0 1.00sec 534149 515096 0 0 0 0.0% 0.0% 0.0% 0.0% 150 2908 4506 41.0% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 149.94 149.94 1.0370 3.0000 534256
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 88.5 59.01% 2908.41 2793 3927 257345
crit 61.5 40.99% 4505.77 4315 6067 276911

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - cat 11406
call_of_the_wild 0 0.0% 2.7 210.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.67 2.67 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:210.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 3693 32.4% 151.2 3.00sec 11037 7181 6637 13526 21379 63.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.21 151.21 0.00 0.00 1.5370 0.0000 1668989
Direct Results Count Pct Average Min Max Total Damage
hit 54.6 36.12% 6636.69 2885 10689 362505
crit 96.6 63.88% 13525.60 5770 21379 1306484

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
kill_command 4818 42.2% 68.0 6.68sec 32009 0 19711 39686 65182 61.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.02 68.02 0.00 0.00 0.0000 0.0000 2177253
Direct Results Count Pct Average Min Max Total Damage
hit 26.1 38.43% 19710.64 17460 32591 515244
crit 41.9 61.57% 39685.69 34919 65182 1662009

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.19
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:926.00
  • base_dd_max:926.00
melee 2895 25.4% 418.1 1.08sec 3130 2896 2137 4309 6505 51.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
418.08 418.08 0.00 0.00 1.0806 0.0000 1308396
Direct Results Count Pct Average Min Max Total Damage
hit 102.7 24.56% 2136.92 1910 3252 219378
crit 215.3 51.49% 4308.82 3819 6505 927629
glance 100.1 23.95% 1611.68 1432 2439 161389

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 14.3 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 14.3 32.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.27 14.27 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.3 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:31.50
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_BM_T11_372
arcane_shot focus 54.8% 901.4 18
kill_command focus 44.9% 1010.4 32
serpent_sting focus 0.3% 42732.0 12
pet - cat
claw focus 100.0% 335.9 33
Resource Gains Type Count focus Average Overflow
cobra_shot focus 178.5 1604.8 9.0 0.1%
fervor focus 1.7 84.8 50.0 0.0%
focus_regen focus 1808.8 2498.5 1.4 0.3%
invigoration focus 96.6 574.9 6.0 0.8%
pet - cat focus
fervor focus 1.7 34.7 20.5 59.0%
focus_fire focus 25.6 85.5 3.3 16.7%
focus_regen focus 1808.8 4076.1 2.3 13.9%
go_for_the_throat focus 85.6 723.5 8.4 15.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 6.9 0.0 70.6sec 70.6sec 15% 12%

Database details

  • id:34471
  • cooldown name:buff_beast_within
  • tooltip:Enraged.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_ap 4.3 0.0 120.5sec 120.5sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cobra_strikes 18.0 3.9 24.4sec 19.8sec 19% 26%

Database details

  • id:53257
  • cooldown name:buff_cobra_strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
culling_the_herd 6.6 90.0 69.0sec 4.7sec 94% 94%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.2 0.0 57.5sec 57.5sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
focus_fire 25.6 0.0 17.5sec 17.5sec 84% 84%

Database details

  • id:82692
  • cooldown name:buff_focus_fire
  • tooltip:Ranged haste increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:100.00%
killing_streak 15.8 0.0 27.8sec 27.8sec 23% 22%

Database details

  • id:
  • cooldown name:buff_killing_streak
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 5.9 0.0 82.8sec 82.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.7sec 300.7sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.4sec 55.4sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bestial_wrath 6.9 0.0 70.6sec 70.6sec 15% 15%

Database details

  • id:
  • cooldown name:buff_bestial_wrath
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 1.7 0.0 420.0sec 420.0sec 7% 7%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 6.6 90.0 69.0sec 4.7sec 94% 93%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-frenzy 26.5 124.7 17.3sec 3.0sec 89% 92%

Database details

  • id:
  • cooldown name:buff_frenzy
  • tooltip:(null)
  • max_stacks:5
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 14.3 0.0 32.9sec 32.9sec 62% 62%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 14.2 381.5 32.9sec 1.1sec 98% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.9 6.1 9.6sec 8.4sec 18% 31%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 70.67%
σ of the average dps 4.1553
2 * σ / μ 0.0297%
95% Confidence Intervall ( μ ± 2σ ) ( 27992.64 - 28009.26 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27988.49 - 28013.42 )
Sample Data
σ 415.5290
Minimum 26558.88
Maximum 29708.46
Spread ( max - min ) 3149.58
Range ( max - min ) / 2 1574.79
Range% 5.62
10th Percentile 27477.16
90th Percentile 28544.33
( 90th Percentile - 10th Percentile ) 1067.17
Approx. Iterations needed for
1% dps error 8
0.1% dps error 880
0.1 scale factor error with delta=300 1534
0.05 scale factor error with delta=300 6139
0.01 scale factor error with delta=300 153479
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B bestial_wrath,if=focus>60
C multi_shot,if=target.adds>5
D cobra_shot,if=target.adds>5
E serpent_sting,if=!ticking
F kill_shot
G rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
H kill_command
I fervor,if=focus<=20
J focus_fire,five_stacks=1,if=!buff.beast_within.up
K arcane_shot,if=focus>=90|buff.beast_within.up
L cobra_shot

Sample Sequence

0134579BEHKKKKKHKKLLJKHLKLKLHLKLKLKHJLLKKLHLLKLKHLGLKJLKHLLKKLHLKLKLHJLLKLKHLLKLKBHKKKKKHKKKIJLHLKLKLHLLKLKHJLLLKLHLLKKLHLJLKLKHLLK9LKHLLJKLKHLLLKKHLLBKKKHKKKKKHJLLLLHLLKLKHLLJLKLHLKLLKHLLKLJKHLLLKLHLLKLKHJLLLKLHLLKLKHLBKKKKHKKKKIHJLLLKLHLKLKLHLJLK9LKHLLKKLHLKLJLKHLKLKLHLLLKLHJLKLKLHLLKLBKHKKKKKHKKJLLLHLLKLKHLKLJKLHLLKLKHLLKLJKHLLKLKHLLLKLHJLKGLKLHLLKLKHLKLBKKHKKKKK9HKJLLLLHLKLKLHLLJKLKHLLKLKHLLLJKLHLKLKLHLLKKLHJLLKKLHLLKLKHLBKKKKHKKKKIHFFJLLLHLLKLFFHLKJLKLHLFFKKHLLLKJLFFHLKLKLHLF9FKJLH4LKKLKHFFLBKKHKKKKKFFHJLLLLHLKFFKHLLJLKLHFFLKLHLKLKFFHJLL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 8466 5817 5345
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 26125 14968 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.39% 29.23% 2305
Melee Haste 13.46% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.11% 6.87% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 2
One with Nature 3
Bestial Discipline 3
Pathfinding 0
Spirit Bond 2
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 3
Fervor 1
Focus Fire 1
Longevity 3
Killing Streak 2
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 1
Ferocious Inspiration 1
Kindred Spirits 2
The Beast Within 1
Invigoration 2
Beast Mastery 1
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 0
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_BM_T11_372
origin="http://chardev.org/?profile=34113"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-2330230311320112121230200000000000000003000000000000000000
glyphs=bestial_wrath/kill_command/arcane_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/bestial_wrath,if=focus>60
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking
actions+=/kill_shot
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/fervor,if=focus<=20
actions+=/focus_fire,five_stacks=1,if=!buff.beast_within.up
actions+=/arcane_shot,if=focus>=90|buff.beast_within.up
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010122000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010122000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372 : 31646dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31646.4 16.03 / 0.05% 2789.4 11.3 11.2 focus 0.00% 59.9
Origin http://chardev.org/?profile=34117
Talents http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
Glyphs
  • steady_shot
  • aimed_shot
  • rapid_fire

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:35856|22369|20358|7411|4497|3320|1583&chds=0,71711&chco=336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++35856++chimera_shot,336600,0,0,15|t++22369++aimed_shot,C79C6E,1,0,15|t++20358++kill_shot,C79C6E,2,0,15|t++7411++steady_shot,C79C6E,3,0,15|t++4497++ranged,C79C6E,4,0,15|t++3320++claw,C79C6E,5,0,15|t++1583++melee,C79C6E,6,0,15&chtt=Hunter_MM_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,18,13,9,8,7,7,5,5,3,1&chds=0,100&chco=C79C6E,C55D54,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,C79C6E&chl=aimed_shot|piercing_shots|steady_shot|chimera_shot|ranged|aimed_shot_mm|wild_quiver_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7pYjxighifsurillehjiffggacfjfcfhcdghfefhggklhkmjlljklkkihdddcbbaccbbbbbbaaabbaaabbaaabbbbbbbbbbcddddeeeedeeeedeeeeedeeeeeeeeedddeeeeeeeedddddddddedddddddddeeddddeeeeeeeeeeeeeeeeeeeeefffggfffeeeeeeedddddddddddddddddddeddddYVXcgjkkjigcYXadgijjiheaZbehijhghhfcaaabdfhhgdbaabceghhfdbabcdfhihfdbbbcefhihfcbbcdegiihecbccefhiigedccdegijjhfdccefhjjigedcdeghiihfedddfgijihffeefgikkjhfeeeefhijhgfeeefgijjhgffefghjkjhgfffghikkjhdZZdinqpmkifbbeimoomljfccfjnonljhf&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:00z004244434685443110zyzyxuvttsrsrrrrrrssssssssssssstssrrqqppoonmmlkjjihhgggfffeeeeddddcccccbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZaaaaaaaabbbbbbbbbbbbbbbbbbaaaaaZZZZZZYYYYYYYYYYYZaaaabbccdefgghhhijjjkklllmllllkjjjiiihhgfeedcccbbaaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZZZZZZZaZaaaaaaaaaaaaabbbbbbccccddeeeeffffffggghhhhhhgggfgggghggg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31646|max=62278&chxp=1,1,51,100&chtt=Hunter_MM_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,3,2,10,20,24,32,42,67,104,141,164,232,275,325,337,439,513,558,562,602,670,632,586,554,505,469,381,363,301,253,187,158,137,94,67,63,48,21,16,11,10,8,3,3,1,2,1,0,1&chds=0,670&chbh=5&chxt=x&chxl=0:|min=28968|avg=31646|max=35120&chxp=0,1,44,100&chtt=Hunter_MM_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372 31646
aimed_shot 7639 24.1% 77.2 5.87sec 44739 22369 27695 59060 70452 54.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
77.18 77.03 0.00 0.00 2.0000 0.0000 3453050
Direct Results Count Pct Average Min Max Total Damage
hit 34.9 45.37% 27695.16 26825 34200 967860
crit 42.1 54.63% 59060.10 55260 70452 2485190

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2158 6.8% 23.4 18.82sec 41709 0 28034 58349 71552 45.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.39 23.35 0.00 0.00 0.0000 0.0000 975722
Direct Results Count Pct Average Min Max Total Damage
hit 12.8 54.65% 28033.65 27244 34734 357735
crit 10.6 45.35% 58349.11 56123 71552 617987

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
chimera_shot 2878 9.1% 35.8 10.59sec 36309 35856 26237 54141 61279 36.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.83 35.73 0.00 0.00 1.0126 0.0000 1300869
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 63.55% 26236.62 25522 29747 595734
crit 13.0 36.45% 54140.81 52576 61279 705135

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 397 1.3% 8.7 10.62sec 20584 20358 15053 31016 34397 36.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.72 8.63 0.00 0.00 1.0111 0.0000 179534
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.93% 15053.42 14794 16697 83024
crit 3.1 36.07% 31016.05 30476 34397 96510

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 5742 18.1% 160.9 2.79sec 16128 0 0 0 0 0.0% 0.0% 0.0% 0.0% 363 7157 0 0.0% 0.0% 80.2%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
160.94 160.94 362.68 362.68 0.0000 1.0000 2595581
Direct Results Count Pct Average Min Max Total Damage
hit 160.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 362.7 100.00% 7156.69 816 35018 2595581

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:633.94
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 2593 8.2% 146.6 3.09sec 7997 4497 5732 11863 13905 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
146.59 146.59 0.00 0.00 1.7782 0.0000 1172270
Direct Results Count Pct Average Min Max Total Damage
hit 92.4 63.06% 5732.32 5550 6750 529925
crit 54.1 36.94% 11862.55 11432 13905 642345

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 817 2.6% 1.4 102.98sec 263569 261198 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2418 3743 40.7% 0.0% 82.9%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.40 1.40 124.85 124.85 1.0091 3.0000 369233
Direct Results Count Pct Average Min Max Total Damage
hit 1.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 74.0 59.29% 2418.22 2353 2717 179007
crit 50.8 40.71% 3742.66 3635 4198 190226

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4070 12.9% 208.0 2.16sec 8846 7411 5919 12352 14446 45.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.99 207.61 0.00 0.00 1.1936 0.0000 1839964
Direct Results Count Pct Average Min Max Total Damage
hit 112.6 54.24% 5919.07 5786 7013 666544
crit 95.0 45.76% 12352.27 11919 14446 1173420

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2063 6.5% 121.7 3.70sec 7663 0 5586 11219 13159 36.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
121.72 121.72 0.00 0.00 0.0000 0.0000 932708
Direct Results Count Pct Average Min Max Total Damage
hit 76.8 63.13% 5585.55 5420 6580 429188
crit 44.9 36.87% 11219.00 10840 13159 503521

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3289
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1707 51.9% 151.2 3.00sec 5102 3320 3355 6775 10441 51.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.21 151.21 0.00 0.00 1.5370 0.0000 771557
Direct Results Count Pct Average Min Max Total Damage
hit 74.0 48.91% 3355.36 1767 5220 248146
crit 77.3 51.09% 6774.75 3535 10441 523411

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1582 48.1% 384.3 1.17sec 1860 1583 1275 2565 3174 51.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
384.35 384.35 0.00 0.00 1.1753 0.0000 714885
Direct Results Count Pct Average Min Max Total Damage
hit 95.4 24.81% 1274.79 1181 1587 121566
crit 196.8 51.20% 2565.27 2361 3174 504798
glance 92.2 23.99% 960.05 885 1190 88521

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372
aimed_shot focus 68.6% 981.8 46
chimera_shot focus 30.7% 825.2 44
serpent_sting focus 0.7% 10542.7 25
pet - cat
claw focus 100.0% 184.3 28
Resource Gains Type Count focus Average Overflow
focus_regen focus 1808.8 2352.6 1.3 2.7%
glyph_aimed_shot focus 52.7 261.0 4.9 1.0%
rapid_recuperation focus 312.3 339.3 1.1 6.0%
steady_shot focus 208.0 2131.0 10.2 0.2%
pet - cat focus
focus_regen focus 1808.8 3658.8 2.0 13.5%
go_for_the_throat focus 54.1 468.6 8.7 13.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.8 67.4 46.6sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.5 0.0 55.8sec 55.8sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.1 68.4 42.9sec 5.7sec 95% 95%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.2 94.8 18.8sec 3.8sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.4 0.0 18.8sec 18.8sec 5% 5%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.0 0.0 80.9sec 80.9sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 18%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.6sec 222.6sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 57.7sec 57.7sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.8 67.4 46.6sec 5.8sec 90% 88%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 237.2 45.0sec 1.8sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 46.2 6.5 9.7sec 8.5sec 16% 30%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 121.7 3.7sec

Statistics & Data Analysis

DPS
Population
Convergence 71.00%
σ of the average dps 8.0163
2 * σ / μ 0.0507%
95% Confidence Intervall ( μ ± 2σ ) ( 31630.40 - 31662.47 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31622.39 - 31670.49 )
Sample Data
σ 801.6279
Minimum 28968.37
Maximum 35119.54
Spread ( max - min ) 6151.16
Range ( max - min ) / 2 3075.58
Range% 9.72
10th Percentile 30637.41
90th Percentile 32693.49
( 90th Percentile - 10th Percentile ) 2056.08
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2566
0.1 scale factor error with delta=300 5712
0.05 scale factor error with delta=300 22848
0.01 scale factor error with delta=300 571206
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
M steady_shot

Sample Sequence

0134568AGHL6L6MIL6L6ML6MIL6ML6ML6MIL6MMLL6MML6MML6MMML6MMLL6GML6MIL6ML6MML6KL6L6MIL6MMML6MML6KL6MIL6ML6MIML6MML6KEFMIL6MMMMFML6KMIL6FMMML6MMMFMML6KML6MFMIL6MMMMFMML6KML6MFMIL6MMMML6FKL6MIMML6AMFMIML6MMMKFMML6MMMMFKL6MIMMMFL6MIMMGH5FL6MMLL6ML6MFMIL6GMML6ML6MMFLML6MIL6MMMFML6MIMMML6FMILL6MMMFMMML6MMMFLMML6MMMFMML6MMMMFML6MIMMKFML6MIMMMFLL6MIMML6FMMML6MMMFKML6MIMMAFMMLL6MMMMFML6MIMMKFML6MIMML6FMMMLMML6FMMML6MMML6FMGHFMIL6ML6KL6L6MFMIGL6MJL6MIL6FMML6JL6MIMFKL6JMIMMFL6MJMIL6MFMIJL6MMMFL6MIJMKL6FMIL6JMMMFL6MIMJKL6MFMIL6JMMMFL6MIJMKL6FMIAL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8471 5822 5345
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.43% 12.43% 2229
Spell Haste 16.28% 10.75% 1376
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20914 11984 190
Melee Hit 8.04% 8.04% 966
Melee Crit 41.98% 28.82% 2229
Melee Haste 14.07% 10.75% 1376
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.12% 6.89% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.60% 11.60% 645

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 2
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 2
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372
origin="http://chardev.org/?profile=34117"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230020000000000000230232003212023122103000000000000000000
glyphs=steady_shot/aimed_shot/rapid_fire
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=cooldown.chimera_shot.remains>5|focus>=80|buff.rapid_fire.up|buff.bloodlust.up|target.health_pct>80
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5345
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2229
# gear_haste_rating=1376
# gear_mastery_rating=645
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_MM_T11_372_Arcane : 31062dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
31062.2 13.66 / 0.04% 2913.8 10.7 10.5 focus 0.00% 59.1
Origin http://chardev.org/?profile=34115
Talents http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
Glyphs
  • steady_shot
  • rapid_fire
  • arcane_shot

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:36158|24685|20475|13060|7371|4315|3613|1689&chds=0,72317&chco=336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++36158++chimera_shot,336600,0,0,15|t++24685++aimed_shot,C79C6E,1,0,15|t++20475++kill_shot,C79C6E,2,0,15|t++13060++arcane_shot,69CCF0,3,0,15|t++7371++steady_shot,C79C6E,4,0,15|t++4315++ranged,C79C6E,5,0,15|t++3613++claw,C79C6E,6,0,15|t++1689++melee,C79C6E,7,0,15&chtt=Hunter_MM_T11_372_Arcane+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:15,14,13,11,9,8,7,6,6,5,3,1&chds=0,100&chco=C55D54,C79C6E,C79C6E,C79C6E,336600,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,336600,C79C6E&chl=piercing_shots|aimed_shot|steady_shot|ranged|chimera_shot|wild_quiver_shot|aimed_shot_mm|arcane_shot|claw|melee|serpent_sting|kill_shot&chtt=Hunter_MM_T11_372_Arcane+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7nSdranVjYfsjogeggffecfdZageYaegdbcdfcabhhgjlhijhhjjhjicccccaYYYZYXWWXYXWVVWWWVUVVVUUUUUUUUUUUTUUUUUUVVUUTTUUUUUUUUTTTUUUUUUUUTTUUUUUUUUUTTUUUUUUUUTTTUUUUUUUUTUUUUVVVVVVUVVVVVVVVUVZccaWVWXXXURSUUUTRQQRSTVWWVTRRRSUVWXWUSRUUSUbhihjihheYWXaeiiiihfcZZbehhdabbYUQOOPSWZbaWSPOOQUYbbZUQONPSWacaXSPNOQUYbcZVROOPSVZcbXTQOORUYbcaWSPPQTXadcZURPPRUYbcbXTQPQSWaccZVRPPRUYbcddaZYWWZccZVUVUSQPQSUWYYXVTSSTVXZZZXUTSTVXZaaYWUTTUWYaaaaYWYcinonkigcZZbfjlmljhebacfillidbZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=100&chtt=Hunter_MM_T11_372_Arcane+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z01y2033444577544321110z0xyvutsrsrrrrrrrrrrrrrrrrrrrrrrqqqpponnmmlkjjiihhgggfffeeeedddddccccbbbbbaaaaaaZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZYYYYYYYYYYZaaaabbbcddegghhhiijjkkllmllllllkjjjiiihgffeddccbbaaZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZZYYZZZZZZZZZZZZaaaaaaaaaaaaaaaaZZZZZZZZZZZaaaaaaaaaaaaaaaaaabbbbbbbccdddeeeeefffggggggggggffgggghhhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=31062|max=61432&chxp=1,1,51,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,5,7,16,18,30,44,56,64,122,137,184,250,281,336,383,487,472,578,562,633,589,588,553,566,464,410,383,372,284,226,213,188,123,105,79,56,35,26,25,12,8,10,4,10,1,1,0,1&chds=0,633&chbh=5&chxt=x&chxl=0:|min=28770|avg=31062|max=33851&chxp=0,1,45,100&chtt=Hunter_MM_T11_372_Arcane+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_MM_T11_372_Arcane 31062
aimed_shot 4207 13.5% 37.2 11.48sec 51171 24685 28309 60342 70327 71.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.16 37.10 0.00 0.00 2.0730 0.0000 1901577
Direct Results Count Pct Average Min Max Total Damage
hit 10.5 28.38% 28308.78 26771 34139 298060
crit 26.6 71.62% 60341.56 55149 70327 1603517

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.158400
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.60
aimed_shot_mm 2197 7.1% 23.6 18.69sec 42042 0 27989 58315 71426 46.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.62 23.58 0.00 0.00 0.0000 0.0000 992989
Direct Results Count Pct Average Min Max Total Damage
hit 12.6 53.41% 27988.79 27189 34673 352435
crit 11.0 46.59% 58315.44 56010 71426 640554

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.176500
  • base_dd_min:776.24
  • base_dd_max:866.59
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.62
arcane_shot 1983 6.4% 68.3 5.41sec 13126 13060 9469 19503 21283 36.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
68.30 68.12 0.00 0.00 1.0051 0.0000 896475
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 63.21% 9469.47 9291 10332 407757
crit 25.1 36.79% 19503.46 19140 21283 488718

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
chimera_shot 2890 9.3% 35.9 10.55sec 36383 36158 26184 54040 61176 37.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.91 35.81 0.00 0.00 1.0062 0.0000 1306431
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 63.02% 26183.97 25473 29697 590791
crit 13.2 36.98% 54039.92 52474 61176 715640

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:10.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes ranged weapon damage plus $, refreshing the duration of your Serpent Sting and healing you for $53353s1% of your total health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.732000
  • base_dd_min:1620.33
  • base_dd_max:1620.33
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
kill_shot 403 1.3% 8.8 10.50sec 20623 20475 15036 30962 34332 36.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.84 8.74 0.00 0.00 1.0072 0.0000 182377
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 63.33% 15036.38 14766 16666 83183
crit 3.2 36.67% 30962.25 30419 34332 99194

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
piercing_shots 4783 15.4% 150.0 3.00sec 14416 0 0 0 0 0.0% 0.0% 0.0% 0.0% 358 6045 0 0.0% 0.0% 79.1%

Stats details: piercing_shots

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
149.99 149.99 357.69 357.69 0.0000 1.0000 2162195
Direct Results Count Pct Average Min Max Total Damage
hit 150.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 357.7 100.00% 6044.85 815 33610 2162195

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed an amount of damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2979.04
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
ranged 3546 11.4% 201.3 2.25sec 7965 4315 5704 11792 13885 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
201.25 201.25 0.00 0.00 1.8458 0.0000 1603041
Direct Results Count Pct Average Min Max Total Damage
hit 126.5 62.86% 5704.47 5541 6740 721684
crit 74.7 37.14% 11792.11 11414 13885 881356

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 5.3 86.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.29 5.29 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 815 2.6% 1.8 127.67sec 210222 208800 0 0 0 0.0% 0.0% 0.0% 0.0% 125 2414 3735 41.0% 0.0% 82.7%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.75 1.75 124.67 124.67 1.0068 3.0000 368560
Direct Results Count Pct Average Min Max Total Damage
hit 1.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 73.5 58.97% 2414.16 2349 2713 177484
crit 51.2 41.03% 3735.43 3629 4191 191076

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
steady_shot 4190 13.5% 213.1 2.11sec 8888 7371 5913 12342 14426 46.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
213.11 212.72 0.00 0.00 1.2058 0.0000 1894137
Direct Results Count Pct Average Min Max Total Damage
hit 113.7 53.47% 5912.84 5777 7003 672566
crit 99.0 46.53% 12342.44 11901 14426 1221572

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.021000
  • base_dd_min:280.18
  • base_dd_max:280.18
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
wild_quiver_shot 2502 8.1% 147.8 3.04sec 7650 0 5570 11178 13141 37.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
147.82 147.82 0.00 0.00 0.0000 0.0000 1130891
Direct Results Count Pct Average Min Max Total Damage
hit 93.0 62.90% 5570.22 5412 6570 517928
crit 54.8 37.10% 11177.67 10823 13141 612963

Action details: wild_quiver_shot

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - cat 3547
call_of_the_wild 0 0.0% 2.0 300.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: call_of_the_wild

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: call_of_the_wild

Static Values
  • id:53434
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • description:Your pet roars, increasing your pet's and your melee and ranged attack power by $s1%. Lasts $d.
claw 1858 52.4% 151.2 3.00sec 5553 3613 3646 7344 10421 51.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
151.21 151.21 0.00 0.00 1.5370 0.0000 839619
Direct Results Count Pct Average Min Max Total Damage
hit 73.2 48.44% 3645.79 1764 5211 267047
crit 78.0 51.56% 7343.82 3527 10421 572571

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
melee 1689 47.6% 409.9 1.10sec 1862 1689 1273 2561 3168 51.6% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
409.91 409.91 0.00 0.00 1.1021 0.0000 763259
Direct Results Count Pct Average Min Max Total Damage
hit 100.1 24.43% 1272.76 1178 1584 127437
crit 211.5 51.58% 2561.23 2356 3168 541573
glance 98.3 23.99% 958.48 884 1188 94248

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 10.6 100.00% 0.00 0 0 0

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Hits can increase the pet's attack power.
  • description:Your pet goes into a killing frenzy. Successful attacks have a chance to increase attack power by $53403s1%. This effect will stack up to $53403u times. Lasts $53401d.
roar_of_courage 0 0.0% 10.6 45.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_courage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.56 10.56 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: roar_of_courage

Static Values
  • id:93435
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.09
  • target:Fluffy_Pillow
  • tooltip:Strength and Agility increased by $w1.
  • description:The beast lets out a roar of courage, increasing the Strength and Agility of all party and raid members by $s1 within $a1 yards. Lasts for $d.

Resources

Resource Usage Type Res% DPR RPE
Hunter_MM_T11_372_Arcane
aimed_shot focus 35.1% 1123.4 46
arcane_shot focus 31.2% 596.7 22
chimera_shot focus 32.8% 826.9 44
serpent_sting focus 0.9% 8408.9 25
pet - cat
claw focus 100.0% 202.3 27
Resource Gains Type Count focus Average Overflow
focus_regen focus 1808.8 2355.7 1.3 1.2%
rapid_recuperation focus 312.6 345.6 1.1 3.8%
steady_shot focus 213.1 2057.7 9.7 0.0%
pet - cat focus
focus_regen focus 1808.8 3468.8 1.9 16.8%
go_for_the_throat focus 74.7 630.8 8.4 15.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
culling_the_herd 9.7 68.3 47.4sec 5.8sec 90% 90%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.6 0.0 55.0sec 55.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
improved_steady_shot 11.5 68.8 41.1sec 5.6sec 96% 97%

Database details

  • id:53220
  • cooldown name:buff_improved_steady_shot
  • tooltip:Ranged attack speed increased by $w1%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
master_marksman 24.4 95.8 18.6sec 3.7sec 70% 100%

Database details

  • id:82925
  • cooldown name:buff_master_marksman
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:60.00%
master_marksman_fire 23.7 0.0 18.7sec 18.7sec 7% 7%

Database details

  • id:82926
  • cooldown name:buff_master_marksman_fire
  • tooltip:Aimed Shot cast time and focus cost reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.1 0.0 80.1sec 80.1sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 5.3 0.0 86.3sec 86.3sec 17% 17%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 222.2sec 222.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.4 0.0 55.0sec 55.0sec 18% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
cat-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cat-call_of_the_wild 2.0 0.0 300.0sec 300.0sec 9% 9%

Database details

  • id:53434
  • cooldown name:buff_call_of_the_wild
  • tooltip:Increases your melee and ranged attack power by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:300.00
  • default_chance:100.00%
cat-culling_the_herd 9.7 68.3 47.4sec 5.8sec 90% 89%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid 10.6 0.0 45.0sec 45.0sec 46% 46%

Database details

  • id:
  • cooldown name:buff_rabid
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
cat-rabid_power_stack 10.6 248.7 45.0sec 1.7sec 100% 98%

Database details

  • id:
  • cooldown name:buff_rabid_power_stack
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
cat-sic_em 56.1 6.6 8.0sec 7.2sec 20% 37%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
trueshot_aura

Database details

  • id:19506
  • cooldown name:buff_trueshot_aura
  • tooltip:Increases attack power by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
wild_quiver 147.8 3.0sec

Statistics & Data Analysis

DPS
Population
Convergence 71.53%
σ of the average dps 6.8280
2 * σ / μ 0.0440%
95% Confidence Intervall ( μ ± 2σ ) ( 31048.54 - 31075.86 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 31041.72 - 31082.68 )
Sample Data
σ 682.8042
Minimum 28769.58
Maximum 33850.84
Spread ( max - min ) 5081.26
Range ( max - min ) / 2 2540.63
Range% 8.18
10th Percentile 30213.71
90th Percentile 31971.08
( 90th Percentile - 10th Percentile ) 1757.36
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1932
0.1 scale factor error with delta=300 4144
0.05 scale factor error with delta=300 16576
0.01 scale factor error with delta=300 414419
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 trueshot_aura
5 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
6 auto_shot
7 snapshot_stats
8 aspect_of_the_hawk,moving=0
9 aspect_of_the_fox,moving=1
A berserking
B explosive_trap,if=target.adds>0
C multi_shot,if=target.adds>5
D steady_shot,if=target.adds>5
E serpent_sting,if=!ticking&target.health_pct<=80
F chimera_shot,if=target.health_pct<=80
G rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
H readiness,wait_for_rapid_fire=1
I steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
J kill_shot
K aimed_shot,if=buff.master_marksman_fire.react
L aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
M arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
N steady_shot

Sample Sequence

0134568AGHL6L6NIL6NL6NL6NIL6NL6LL6NIL6NL6NINL6KL6NIL6NNNL6NGNL6NNL6KL6L6NIL6NNL6NNL6NNLNL6NINL6NNLL6NNNL6NNL6NNNENFNIKMNNNMFNMNIKNNMFNMNINNMNFMKNINNMNFMNIMKNNMFNMNINNMKFNMNINNMNMFNIMKNNNMAFNNL6NNNL6NNNEENNFNNMKNNNMFNMNINNMNFGH5KFNIL6NNL6NNL6NFGNNLL6NL6NIL6FNNL6NNNMNFKMNINNMNFMNIMNKNNFMNMNINNKFMMNINNMNFMNIMNNNNFMNMNIKNMNFMNIMNNNMFNMNIKNNMFNMNINKNMFNIMMNNNALFNNL6NNNL6KFMNIMNNNMFNMNINKNMFMNIMNNNNMFKMNINNMNFMGHNFNIL6NL6NL6KFNIGL6L6NNJL6NFNIL6NL6JKMMFNIMMJNNNFMKMNIJNNMFMNMNIJNMNFKMNIJNMNFMNIMJNNMFKMNIJNNMFMNMNIJNKFMNIMNJNMFNIMMNAJL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 682 101 20
Agility 8449 5801 5325
Stamina 7597 5977 5838
Intellect 118 113 20
Spirit 126 126 20
Health 145079 122455 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.86% 12.86% 2305
Spell Haste 15.66% 10.15% 1300
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20860 11942 190
Melee Hit 8.04% 8.04% 966
Melee Crit 42.34% 29.18% 2305
Melee Haste 12.35% 10.15% 1300
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 12.08% 6.84% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.96% 11.96% 710

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 2
Bestial Discipline 3
Pathfinding 0
Spirit Bond 0
Frenzy 3
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 3
Careful Aim 2
Silencing Shot 1
Concussive Barrage 0
Piercing Shots 3
Bombardment 2
Trueshot Aura 1
Termination 1
Resistance is Futile 0
Rapid Recuperation 2
Master Marksman 3
Readiness 1
Posthaste 2
Marked for Death 2
Chimera Shot 1
Survival Rank
Hunter vs. Wild 0
Pathing 2
Improved Serpent Sting 0
Survival Tactics 0
Trap Mastery 0
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 0
Counterattack 0
Lock and Load 0
Resourcefulness 0
Mirrored Blades 0
T.N.T. 0
Toxicology 0
Wyvern Sting 0
Noxious Stings 0
Hunting Party 0
Sniper Training 0
Serpent Spread 0
Black Arrow 0

Profile

#!./simc

hunter=Hunter_MM_T11_372_Arcane
origin="http://chardev.org/?profile=34115"
level=85
race=troll
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0230030000000000000230232103211023122102000000000000000000
glyphs=steady_shot/rapid_fire/arcane_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/trueshot_aura
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60|buff.rapid_fire.react
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/berserking
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health_pct<=80
actions+=/chimera_shot,if=target.health_pct<=80
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_improved_steady_shot.up&buff.improved_steady_shot.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/aimed_shot,if=target.health_pct>80|buff.rapid_fire.up|buff.bloodlust.up|buff.berserking.up
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health_pct<80&!buff.rapid_fire.up&!buff.bloodlust.up&!buff.berserking.up)
actions+=/steady_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_crit,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=65crit
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=mastery_haste,enchant=gnomish_xray,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=5325
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2305
# gear_haste_rating=1300
# gear_mastery_rating=710
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=cat

Hunter_SV_T11_372 : 26518dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26518.4 7.41 / 0.03% 2621.8 10.1 10.0 focus 0.00% 51.1
Origin http://chardev.org/?profile=34116
Talents http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
Glyphs
  • arcane_shot
  • explosive_shot
  • kill_shot

Charts

http://8.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:34052|31826|28172|17485|11644|3996|3849|1429|901&chds=0,68104&chco=C41F3B,9482C9,C79C6E,69CCF0,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++34052++explosive_shot,C41F3B,0,0,15|t++31826++black_arrow,9482C9,1,0,15|t++28172++kill_shot,C79C6E,2,0,15|t++17485++arcane_shot,69CCF0,3,0,15|t++11644++cobra_shot,336600,4,0,15|t++3996++claw,C79C6E,5,0,15|t++3849++ranged,C79C6E,6,0,15|t++1429++melee,C79C6E,7,0,15|t++901++wolverine_bite,C79C6E,8,0,15&chtt=Hunter_SV_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:28,23,14,7,7,6,5,5,4,1,0&chds=0,100&chco=336600,C41F3B,C79C6E,C79C6E,69CCF0,336600,C79C6E,9482C9,C79C6E,C79C6E,336600&chl=cobra_shot|explosive_shot|ranged|claw|arcane_shot|serpent_sting|melee|black_arrow|kill_shot|wolverine_bite|serpent_sting_burst&chtt=Hunter_SV_T11_372+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:yuXYn04mmz677ut2323upuwwzxiZYZgqnmsvwyyqswuvyruzzyzsjgggilnorsrsttuvutttsssplfbZabdgknqstuvwwwvuuuttrmieccdehjmoqsstuuuutttsrpmiecbbdfhkmoqsttuuutttsrpmjgdccdfhkmoqstuuuuuuttsqnligffghjlnpqsttuuuuuttrpnkifedefhjlmoqrsttttttssrponmmnnpqrsttuuuutuuuttrqomkihgghjkmoprsttuuuuttsqomkigfffhikmnpqrstttttsrqonmlmllmoprtttuvvvutttssrpnkihggghijlnpqrsstuuttsrpomkigggghiklmoqrrsssttsqpnlkihggfghjkmnoqrrsssssrqomlkjklloqrtvvwwwvvvuutrqpnljihhgghijlmnopqrsssrrp&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Hunter_SV_T11_372+Focus+Timeline&chts=dddddd,18&chco=C0B84F http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:22333464444468765422zyxxwwvtuutttsrsrrrsrrrqpoonnnmmmmmmmnnnnnnnononnmmmlllkkkkkkkkkkkkkllllllkkjjjjjjjijijjjjjjjjkkklkkkkkjkjjjjjjjjjjjjjjjkjjjjjiiiiihihiiiiiijjjjkkkkkkkkkkkkjjkjjkjjjkkkkkkkkkjjjjjiiiiiiihiiiiiiijjjjjjjjjijijjijjjjjkjkkkllllllllllkkkkkkkkkkkkkkkkkkkkkkkjjjjjjjjjjjjjjjjjjkkkklllllmmmmnnoopooppppppppooonnnmmllllllllmmmmmmnnnnnnnnnmmmmmmmmmmmnnnnnnnoonnonnnnmnnmmmmmmmmmmmnnnnnnnnnnnnnnnnnoooooppppppppppppppooooooooooooopppppppppqqpq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26518|max=40880&chxp=1,1,65,100&chtt=Hunter_SV_T11_372+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,4,11,11,18,40,52,70,89,136,174,241,283,323,400,423,463,565,588,640,627,634,555,558,503,440,401,362,313,242,208,141,118,101,72,53,40,23,21,18,10,8,5,4,5,0,0,1,1&chds=0,640&chbh=5&chxt=x&chxl=0:|min=25293|avg=26518|max=28124&chxp=0,1,43,100&chtt=Hunter_SV_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Hunter_SV_T11_372 26518
arcane_shot 1782 6.7% 45.8 9.71sec 17579 17485 12471 25810 29416 38.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.82 45.76 0.00 0.00 1.0054 0.0000 805411
Direct Results Count Pct Average Min Max Total Damage
hit 28.2 61.53% 12471.00 12080 14280 351101
crit 17.6 38.47% 25810.14 24885 29416 454310

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:22.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $ as Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.048300
  • base_dd_min:289.86
  • base_dd_max:289.86
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 1299 4.9% 18.4 25.23sec 31999 31826 0 0 0 0.0% 0.0% 0.0% 0.0% 90 4611 9673 38.2% 0.0% 59.6%

Stats details: black_arrow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.35 18.31 89.74 89.74 1.0054 3.0000 587245
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 55.5 61.82% 4611.08 4458 5425 255820
crit 34.3 38.18% 9673.37 9317 11339 331424

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $o1 Shadow damage over $d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.095000
  • base_td:407.33
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
cobra_shot 7473 28.2% 210.2 2.14sec 16068 11644 10637 22110 25195 47.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
210.25 209.86 0.00 0.00 1.3799 0.0000 3378235
Direct Results Count Pct Average Min Max Total Damage
hit 110.0 52.41% 10636.69 10408 12231 1169887
crit 99.9 47.59% 22110.39 21440 25195 2208348

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals weapon damage plus $ in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s2 sec. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.017000
  • base_dd_min:276.81
  • base_dd_max:276.81
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
explosive_shot 6126 23.1% 80.8 5.61sec 34255 34052 0 0 0 0.0% 0.0% 0.0% 0.0% 240 7777 16319 44.2% 0.0% 35.2%

Stats details: explosive_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
80.83 80.67 239.63 239.63 1.0060 0.6634 2768984
Direct Results Count Pct Average Min Max Total Damage
hit 80.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 133.6 55.76% 7776.59 7501 9310 1039155
crit 106.0 44.24% 16319.06 15678 19458 1729830

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:44.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:Taking $w1 Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing $ Fire damage. The charge will blast the target every second for an additional $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.232000
  • base_td:353.32
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
kill_shot 947 3.6% 15.1 5.86sec 28333 28172 18199 37656 43151 53.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.11 14.92 0.00 0.00 1.0057 0.0000 427983
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 46.10% 18198.64 17321 20947 125176
crit 8.0 53.90% 37656.47 35682 43151 302807

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage plus ${$RAP*0.30+$m1}. Kill Shot can only be used on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:543.48
  • base_dd_max:543.48
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
ranged 3842 14.5% 207.3 2.19sec 8378 3849 5942 12291 14027 38.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
207.29 207.29 0.00 0.00 2.1764 0.0000 1736619
Direct Results Count Pct Average Min Max Total Damage
hit 127.8 61.63% 5941.59 5765 6809 759079
crit 79.5 38.37% 12290.99 11876 14027 977541

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 2.0 300.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:focus
  • tree:marksmanship
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases ranged attack speed by $s1%.
  • description:Increases ranged attack speed by $s1% for $d.
serpent_sting 1678 6.3% 1.0 0.00sec 758522 731531 0 0 0 0.0% 0.0% 0.0% 0.0% 150 3137 6578 53.2% 0.0% 99.5%

Stats details: serpent_sting

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 149.94 149.94 1.0369 3.0000 744657
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 70.2 46.83% 3137.03 3047 3676 220295
crit 79.7 53.17% 6577.70 6369 7682 524362

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • tree:survival
  • range:-1.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 Nature damage every $t1 seconds.
  • description:Causes ${$RAP*0.4+($m1*$d/3)} Nature damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:460.22
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
serpent_sting_burst 15 0.1% 1.0 0.00sec 6932 0 4834 9959 9959 40.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 0.0000 0.0000 6932
Direct Results Count Pct Average Min Max Total Damage
hit 0.6 59.06% 4834.42 4834 4834 2855
crit 0.4 40.94% 9958.90 9959 9959 4077

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:3903.54
  • base_dd_max:3903.54
pet - wind_serpent 3388
claw 1825 53.9% 134.3 3.36sec 6142 3996 4231 8521 12431 44.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.28 134.28 0.00 0.00 1.5370 0.0000 824838
Direct Results Count Pct Average Min Max Total Damage
hit 74.4 55.44% 4231.07 1978 6215 314992
crit 59.8 44.56% 8520.63 3955 12431 509846

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Claw the enemy, causing ${$M1+(($RAP*0.40)*0.20)} damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.195200
  • base_dd_min:131.82
  • base_dd_max:187.74
lightning_breath 0 0.0% 15.5 30.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_breath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.46 15.46 0.00 0.00 1.4623 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.5 100.00% 0.00 0 0 0

Action details: lightning_breath

Static Values
  • id:24844
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases magic damage taken by $s2%.
  • description:Breathes lightning, increasing magic damage taken by $s2% for $d.
melee 1428 42.1% 321.9 1.40sec 2005 1429 1442 2899 3779 44.5% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
321.85 321.85 0.00 0.00 1.4032 0.0000 645282
Direct Results Count Pct Average Min Max Total Damage
hit 101.2 31.43% 1441.63 1321 1889 145847
crit 143.3 44.54% 2899.01 2643 3779 415541
glance 77.3 24.03% 1084.67 991 1417 83894

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
roar_of_recovery 0 0.0% 2.7 181.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: roar_of_recovery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.75 2.75 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.7 100.00% 0.00 0 0 0

Action details: roar_of_recovery

Static Values
  • id:53517
  • school:nature
  • resource:focus
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1 focus every $t1 sec.
  • description:Your pet's inspiring roar restores $o1 focus over $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
wolverine_bite 135 4.0% 45.1 10.09sec 1351 901 932 1874 2471 44.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolverine_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.10 45.10 0.00 0.00 1.4992 0.0000 60937
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 55.52% 932.32 851 1236 23345
crit 20.1 44.48% 1873.56 1701 2471 37592

Action details: wolverine_bite

Static Values
  • id:53508
  • school:physical
  • resource:focus
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A fierce attack causing $ damage, that your pet can use after it makes a critical attack. Cannot be dodged, blocked or parried.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1.00
  • base_dd_max:1.00

Resources

Resource Usage Type Res% DPR RPE
Hunter_SV_T11_372
arcane_shot focus 22.0% 799.1 22
black_arrow focus 14.0% 914.2 35
explosive_shot focus 63.4% 955.9 36
serpent_sting focus 0.5% 30340.9 25
pet - wind_serpent
claw focus 100.0% 222.0 28
Resource Gains Type Count focus Average Overflow
cobra_shot focus 210.2 1886.9 9.0 0.3%
focus_regen focus 1808.8 2244.1 1.2 0.6%
roar_of_recovery focus 8.1 80.8 9.9 0.8%
thrill_of_the_hunt focus 21.7 305.6 14.1 2.1%
pet - wind_serpent focus
focus_regen focus 1808.8 3020.1 1.7 15.9%
go_for_the_throat focus 79.5 650.6 8.2 18.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
culling_the_herd 18.3 41.6 24.9sec 7.5sec 82% 81%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
essence_of_the_cyclone 8.3 0.0 57.6sec 57.6sec 18% 18%

Database details

  • id:
  • cooldown name:buff_essence_of_the_cyclone
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:50.00
  • default_chance:10.00%
lock_and_load 7.5 0.0 56.3sec 56.3sec 5% 12%

Database details

  • id:56453
  • cooldown name:buff_lock_and_load
  • tooltip:Your next Arcane Shot or Explosive Shot spells trigger no cooldown and cost no focus.
  • max_stacks:2
  • duration:12.00
  • cooldown:22.00
  • default_chance:12.00%
prestors_talisman_of_machination 5.9 0.0 82.7sec 82.7sec 19% 19%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
rapid_fire 2.0 0.0 300.6sec 300.6sec 7% 7%

Database details

  • id:3045
  • cooldown name:buff_rapid_fire
  • tooltip:Increases ranged attack speed by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
tolvir_potion 2.0 0.0 394.7sec 394.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
xray_targeting 8.0 0.0 58.1sec 58.1sec 17% 19%

Database details

  • id:
  • cooldown name:buff_xray_targeting
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:0.00%
wind_serpent-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 6%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-culling_the_herd 18.3 41.6 24.9sec 7.5sec 82% 78%

Database details

  • id:70893
  • cooldown name:buff_culling_the_herd
  • tooltip:Increases damage you and your pet deal by $w1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-owls_focus 40.2 0.0 11.0sec 11.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_owls_focus
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:30.00%
wind_serpent-sic_em 17.1 0.5 25.3sec 24.6sec 7% 13%

Database details

  • id:
  • cooldown name:buff_sic_em
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
wind_serpent-wolverine_bite 46.1 177.2 9.9sec 2.0sec 89% 100%

Database details

  • id:
  • cooldown name:buff_wolverine_bite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
aspect_of_the_hawk

Database details

  • id:13165
  • cooldown name:buff_aspect_of_the_hawk
  • tooltip:Increases ranged attack power by $w1.
  • max_stacks:1
  • duration:-0.00
  • cooldown:1.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sniper_training

Database details

  • id:64420
  • cooldown name:buff_sniper_training
  • tooltip:Damage done by your Steady Shot and Cobra Shot increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:300.00%

Uptimes

%

Procs

Count Interval
lock_and_load 7.5 56.3sec
thrill_of_the_hunt 21.7 20.0sec

Statistics & Data Analysis

DPS
Population
Convergence 70.66%
σ of the average dps 3.7066
2 * σ / μ 0.0280%
95% Confidence Intervall ( μ ± 2σ ) ( 26510.98 - 26525.81 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26507.28 - 26529.52 )
Sample Data
σ 370.6650
Minimum 25293.32
Maximum 28123.79
Spread ( max - min ) 2830.47
Range ( max - min ) / 2 1415.23
Range% 5.34
10th Percentile 26060.29
90th Percentile 27005.39
( 90th Percentile - 10th Percentile ) 945.10
Approx. Iterations needed for
1% dps error 7
0.1% dps error 781
0.1 scale factor error with delta=300 1221
0.05 scale factor error with delta=300 4885
0.01 scale factor error with delta=300 122126
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 hunters_mark
3 summon_pet
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
5 auto_shot
6 snapshot_stats
7 aspect_of_the_hawk,moving=0
8 aspect_of_the_fox,moving=1
9 blood_fury
A explosive_trap,if=target.adds>0
B multi_shot,if=target.adds>2
C cobra_shot,if=target.adds>2
D serpent_sting,if=!ticking
E rapid_fire
F explosive_shot,non_consecutive=1
G black_arrow,if=!ticking
H kill_shot
I arcane_shot,if=focus>=70&buff.lock_and_load.down
J cobra_shot

Sample Sequence

0134579DEFGJJJIFJJJIIFJFJFIFJJIJIFGJJJJFJJIJIFJJJIFJJJIFGJJJFJJJFJFIFJJIJFJGJJFJJJIFJJFJFIFJJIJGFJJJJFJJJFJFIFJ9JIJFJGJJFJJJJFJFIFJJIJFJGJJFJJJJFJJJFJFIFJJGJJFJIJIJFJJIJFJJJIFJGJJFJJFJFJFJJJIFJJIGJFJJJIFJJIJ9FJJIJFJIGJJFJJJIJFJJFJFIFJJIJFJGJJFJJJJFJFJFIFJJJEIFJGJJJFJJJIJFJJJIJFJJIJFJGJJFJJJJFJJJIJFJJIJFGJJJ9FJFJFIFJJIJFJJJGFJJJIFJJJJFJJIJFJJGJFJJIJFJJIJFJFJFIFJGJIJFJJHHIFJJJIJFHHIJGJFJJJHFHJJJFJJIHHFJGJJ9JFJF4FHHJIJFJJIJFHGHJJFJJJJFHHJJIFJJJJFGHHJFJFJFJJHH

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 684 103 20
Agility 9526 6553 5367
Stamina 7598 5978 5838
Intellect 119 114 20
Spirit 127 127 20
Health 145093 122469 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.43% 9.43% 966
Spell Crit 17.07% 12.07% 2164
Spell Haste 16.68% 11.13% 1425
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 21332 13445 190
Melee Hit 8.04% 8.04% 966
Melee Crit 44.86% 30.71% 2164
Melee Haste 14.46% 11.13% 1425
Expertise 0.00 0.00 0
Armor 19402 15326 15326
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 14.07% 8.30% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.32% 11.32% 596

Gear

Encoded
head lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
shirt empty
chest voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2 mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1 essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
off_hand empty
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Beast Mastery Rank
Improved Kill Command 0
One with Nature 0
Bestial Discipline 1
Pathfinding 0
Spirit Bond 0
Frenzy 0
Improved Mend Pet 0
Cobra Strikes 0
Fervor 0
Focus Fire 0
Longevity 0
Killing Streak 0
Crouching Tiger, Hidden Chimera 0
Bestial Wrath 0
Ferocious Inspiration 0
Kindred Spirits 0
The Beast Within 0
Invigoration 0
Beast Mastery 0
Marksmanship Rank
Go for the Throat 2
Efficiency 3
Rapid Killing 0
Sic 'Em! 2
Improved Steady Shot 0
Careful Aim 2
Silencing Shot 0
Concussive Barrage 0
Piercing Shots 0
Bombardment 0
Trueshot Aura 0
Termination 0
Resistance is Futile 0
Rapid Recuperation 0
Master Marksman 0
Readiness 0
Posthaste 0
Marked for Death 0
Chimera Shot 0
Survival Rank
Hunter vs. Wild 0
Pathing 3
Improved Serpent Sting 2
Survival Tactics 2
Trap Mastery 3
Entrapment 0
Point of No Escape 0
Thrill of the Hunt 3
Counterattack 0
Lock and Load 2
Resourcefulness 3
Mirrored Blades 0
T.N.T. 2
Toxicology 2
Wyvern Sting 1
Noxious Stings 2
Hunting Party 1
Sniper Training 3
Serpent Spread 1
Black Arrow 1

Profile

#!./simc

hunter=Hunter_SV_T11_372
origin="http://chardev.org/?profile=34116"
level=85
race=orc
role=attack
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#hunter-0010000000000000000230202000000000000003223003023022121311
glyphs=arcane_shot/explosive_shot/kill_shot
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/hunters_mark
actions+=/summon_pet
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=60
actions+=/auto_shot
actions+=/snapshot_stats
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/blood_fury
actions+=/explosive_trap,if=target.adds>0
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking
actions+=/rapid_fire
actions+=/explosive_shot,non_consecutive=1
actions+=/black_arrow,if=!ticking
actions+=/kill_shot
actions+=/arcane_shot,if=focus>=70&buff.lock_and_load.down
actions+=/cobra_shot
head=lightningcharged_headguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257crit_197mastery_578sta,reforge=mastery_haste,gems=agile_shadowspirit_20agi_20crit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_hit
shoulders=lightningcharged_spaulders,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,reforge=mastery_crit,gems=67agi_10mastery,enchant=50agi_25mastery
chest=voltage_source_chestguard,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_227crit_247haste_578sta,reforge=haste_hit,gems=67agi_40agi,enchant=20all
waist=coil_of_tenthousand_screams,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1433armor_171crit_191haste_429sta,gems=67agi_40agi_10haste
legs=lightningcharged_legguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2230armor_257crit_217haste_578sta,gems=40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,gems=20agi_20hit_10agi,enchant=25agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,enchant=50agi
hands=lightningcharged_gloves,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171haste_429sta,gems=20agi_20hit_10agi,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,enchant=40agi
finger2=mistral_circle_of_the_stormblast,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143hit_143crit,enchant=40agi,suffix=133
trinket1=essence_of_the_cyclone,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178crit_10%_10dur_50cd
trinket2=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_haste,enchant=22agi
main_hand=malevolence,heroic=1,ilevel=372,quality=epic,stats=385agi_257crit_257mastery_578sta,reforge=mastery_haste,enchant=130agi,weapon=staff_2.40speed_1350min_2027max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,enchant=gnomish_xray,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=5367
# gear_stamina=5838
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_hit_rating=966
# gear_crit_rating=2164
# gear_haste_rating=1425
# gear_mastery_rating=596
# gear_armor=15326
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=malevolence,heroic=1,weapon=staff_2.40speed_1350min_2027max
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max,enchant=gnomish_xray
pet=cat,cat talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=devilsaur,devilsaur talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=raptor,raptor talents=200000030300003010102000000000000000000000000000000000000000000 active=owner pet=wind_serpent,wind_serpent talents=000000000000000000000000000000000000000002000000023300002110020 active=owner pet=wolf,wolf talents=200000030300003010102000000000000000000000000000000000000000000 active=owner summon_pet=wind_serpent

Mage_Arcane_T11_372 : 30311dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
30310.9 15.42 / 0.05% 14.2 2138.9 1923.3 mana 0.00% 148.1
Origin http://chardev.org/?profile=35357
Talents http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
Glyphs
  • evocation
  • arcane_power
  • slow
  • mirror_image
  • arcane_brilliance
  • conjuring
  • arcane_blast
  • arcane_missiles
  • mage_armor

Charts

http://7.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:41901|35697|18763|16544|1396&chds=0,83801&chco=C41F3B,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++41901++flame_orb,C41F3B,0,0,15|t++35697++arcane_blast,69CCF0,1,0,15|t++18763++arcane_barrage,69CCF0,2,0,15|t++16544++arcane_missiles,69CCF0,3,0,15|t++1396++mirror_arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:87,8,3,2,1,0&chds=0,100&chco=69CCF0,69CCF0,C41F3B,69CCF0,69CCF0,C41F3B&chl=arcane_blast|arcane_missiles|flame_orb_tick|mirror_arcane_blast|arcane_barrage|ignite&chtt=Mage_Arcane_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:r665876420zxvtrpnmlkihfdcaYXVTRQPPPRWdksz233321011222221001122221000111110zz001100zzzz0000zxwwwxxxxxwvvwwxxxwwvvvwwwwwwvtsrrrtsrpomkjihfedcbaZYXVUTSRQPOOONNNNOOPSXdjpv03445455554444333322222211111111110001111100000000000zz000000zzzzz00zzzzzzzzzz01210yxvtsqpnmkjihgedcbaZYWVUSQPPOOONNOOOPSWbgmrwy022344444444444433322222221111000000zzzzzyyyyxxxwwwwvvvuuuttttsssrrrrqqqrrrrrrrqqponmlkjihgfedcbaZYXWVUUTSRQQPOONNMMMNNPRTWYbdfhjlmopqrsstttttttttttsssrrrqq&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=116857&chtt=Mage_Arcane_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:6677777665444320ywusromjgdaYVTSQPOOOONMLLLKLMOOOPQRSRSTTSSSTUUVVUTTTUUUUVVUTTTTTVVUTSTTTTUUUTSTTTUUUUSRRSSSTUUUVUWYZbcdeghjllmnnonnnmnmlkihgedbaYYXWUSRQPNMLKJIIIIIIIIIJJKLLMNOPRSTUUVVVWWWWWWXXXXXXWWWWVUUUUUTTTTTSSSSSSTTSSSSSSTTTTSSTTTSSSSSTUVWXYZabcdeffgghhhiihhggfedcbaZYXWVUTSRQPOMLKJIIIIIIIJJJKKLMNOQRSSTTUUUUUUUVVVVVVVVUUUUUUUUUTUUUUUUUUUUUUUUUUUUUUUVVVVVWWXYZabcdefghijkkllmmmlllkjihgfedcbaZZYXWWVUTSSRQPOONNMMLLLKKLLLMMNOPQRRSTUUVVWXXXXYYYYYYYYX&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=30311|max=78162&chxp=1,1,39,100&chtt=Mage_Arcane_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,5,7,15,24,23,39,56,80,104,154,182,257,293,334,389,466,553,566,582,593,610,584,544,525,476,455,390,301,262,231,214,145,120,102,74,81,48,32,24,17,9,9,9,4,5,3,0,1&chds=0,610&chbh=5&chxt=x&chxl=0:|min=27758|avg=30311|max=33448&chxp=0,1,45,100&chtt=Mage_Arcane_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Arcane_T11_372 30311
arcane_barrage 162 0.5% 3.1 78.61sec 23603 18763 18056 37166 44712 31.3% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.11 3.08 0.00 0.00 1.2580 0.0000 73336
Direct Results Count Pct Average Min Max Total Damage
hit 2.1 67.34% 18056.37 14233 21994 37478
crit 1.0 31.30% 37166.49 29246 44712 35858
miss 0.0 1.36% 0.00 0 0 0

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1915.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.907000
  • base_dd_min:1192.00
  • base_dd_max:1456.89
arcane_blast 26278 86.7% 277.3 1.63sec 42835 35697 32853 67110 136738 30.4% 1.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
277.26 277.26 0.00 0.00 1.2000 0.0000 11876589
Direct Results Count Pct Average Min Max Total Damage
hit 189.1 68.19% 32853.33 17165 66529 6211343
crit 84.4 30.45% 67110.49 35281 136738 5665246
miss 3.8 1.36% 0.00 0 0 0

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:870.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $s1 Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast and Arcane Explosion is increased by $36032s1%, Arcane Blast casting time is reduced by ${$36032m3/-1000}.1 sec and Arcane Blast mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast or Arcane Explosion is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.057000
  • base_dd_min:1764.41
  • base_dd_max:2050.53
arcane_missiles 2311 7.6% 27.6 14.66sec 37814 16544 0 0 0 0.0% 0.0% 0.0% 0.0% 138 5463 11226 39.1% 1.4% 12.4%

Stats details: arcane_missiles

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.62 27.62 137.53 136.61 2.2857 0.4091 1044355
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 81.3 59.49% 5462.94 4355 6942 443944
crit 53.5 39.15% 11226.35 8942 14298 600412
miss 1.9 1.37% 0.00 0 0 0

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches Arcane Missiles at the enemy, causing $7268s1 Arcane damage every $5143t2 sec for $5143d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.278000
  • base_dd_min:404.93
  • base_dd_max:404.93

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches $?[five]?[four][three] waves of Arcane Missiles at the enemy over $d, causing $7268s1 Arcane damage per wave. Each offensive spell you cast has a $79684h% chance to activate Arcane Missiles.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
arcane_power 0 0.0% 4.4 119.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.44 4.44 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.4 100.00% 0.00 0 0 0

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increased damage and mana cost for your spells.
  • description:When activated, you deal $s1% more spell damage but spells cost $s2% more mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
evocation 0 0.0% 3.5 126.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: evocation

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.53 3.53 0.00 0.00 4.9177 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:6.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gain $s1% of total mana every $t1 sec.
  • description:Gain $s1% of your mana instantly and another ${$m1*3}% of your total mana over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb 851 2.8% 7.8 60.84sec 49459 41901 0 0 0 0.0% 1.4% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.77 7.77 114.68 0.00 1.1804 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 98.58% 0.00 0 0 0
miss 0.1 1.42% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_tick 851 2.8% 114.7 3.73sec 3352 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2581 5278 29.9% 1.4% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.68 0.00 0.00 114.68 0.0000 0.0000 384447
Tick Results Count Pct Average Min Max Total Damage
hit 78.8 68.72% 2581.02 1656 4233 203399
crit 34.3 29.91% 5278.36 3401 8709 181048
miss 1.6 1.37% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 105 0.3% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 49 962 0 0.0% 0.0% 21.8%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 31.33 49.30 49.30 0.0000 2.0000 47408
Direct Results Count Pct Average Min Max Total Damage
hit 31.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 49.3 100.00% 961.56 443 5136 47408

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1348.57
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
presence_of_mind 0 0.0% 5.5 91.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.5 100.00% 0.00 0 0 0

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:mana
  • tree:arcane
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell.
pet - mirror_image_3 727
mirror_arcane_blast 727 100.0% 78.3 14.88sec 3489 1396 3392 5086 7362 9.7% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_arcane_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
78.33 78.33 0.00 0.00 2.5000 0.0000 273279
Direct Results Count Pct Average Min Max Total Damage
hit 69.1 88.25% 3391.98 2114 4908 234455
crit 7.6 9.75% 5085.67 3171 7362 38824
miss 1.6 2.01% 0.00 0 0 0

Action details: mirror_arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target with energy, dealing ${($m1+$M1)/2} Arcane damage. Each time you cast Arcane Blast, the damage of Arcane Blast is increased by $36032s1% and mana cost is increased by $36032s2%. Effect stacks up to $36032u times and lasts $36032d or until any Arcane damage spell except Arcane Blast is cast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.275000
  • base_dd_min:224.56
  • base_dd_max:260.98

Resources

Resource Usage Type Res% DPR RPE
Mage_Arcane_T11_372
arcane_barrage mana 0.5% 14.4 1634
arcane_blast mana 96.9% 12.7 3379
conjure_mana_gem mana 1.4% 0.0 13182
flame_orb mana 0.6% 61.9 799
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29226.7 16.2 0.9%
clearcasting none 25.0 17817.2 713.0 0.0%
evocation mana 14.1 246755.8 17464.2 0.1%
flask mana 1.0 4725.0 4725.0 0.0%
food mana 1.0 1417.5 1417.5 0.0%
initial_mana none 1.0 107548.4 107548.4 0.0%
mage_armor mana 1808.8 381619.0 211.0 0.9%
mana_gem mana 4.2 51244.9 12103.2 0.0%
master_of_elements mana 119.7 23198.0 193.8 0.5%
mp5_regen mana 1808.8 78029.2 43.1 0.8%
replenishment mana 1808.8 53047.5 29.3 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
arcane_blast 31.5 245.7 14.4sec 1.6sec 83% 97%

Database details

  • id:36032
  • cooldown name:buff_arcane_blast
  • tooltip:Arcane Blast and Arcane Explosion damage increased by $w1%. Arcane Blast casting time reduced by ${$m3/-1000}.1 sec and mana cost increased by $w2%.
  • max_stacks:4
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_missiles 28.1 101.7 15.8sec 3.5sec 65% 65%

Database details

  • id:79683
  • cooldown name:buff_arcane_missiles
  • tooltip:Arcane Missiles activated.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:40.00%
arcane_potency 29.0 1.6 15.9sec 15.0sec 18% 17%

Database details

  • id:
  • cooldown name:buff_arcane_potency
  • tooltip:(null)
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
arcane_power 4.4 0.0 119.4sec 119.4sec 15% 30%

Database details

  • id:12042
  • cooldown name:buff_arcane_power
  • tooltip:Increased damage and mana cost for your spells.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 176.9 100.1 2.6sec 1.6sec 74% 74%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.1 0.0 18.4sec 18.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
improved_mana_gem 4.2 0.0 122.4sec 122.4sec 14% 14%

Database details

  • id:
  • cooldown name:buff_improved_mana_gem
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 8.8 0.0 54.1sec 54.1sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 9.5 0.0 49.8sec 49.8sec 25% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shard_of_woe 7.8 0.0 61.8sec 61.8sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shard_of_woe
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.4 0.0 113.4sec 113.4sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 118.2sec 118.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 75.6 185.0sec 4.8sec 17% 17%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
focus_magic_feedback

Database details

  • id:
  • cooldown name:buff_focus_magic_feedback
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mage_armor

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
arcane_blast_0 11.4%
arcane_blast_1 10.9%
arcane_blast_2 10.7%
arcane_blast_3 10.4%
arcane_blast_4 56.6%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 4.2 122.4sec
munched_ignite 3.0 92.7sec
rolled_ignite 4.9 66.0sec

Statistics & Data Analysis

DPS
Population
Convergence 71.30%
σ of the average dps 7.7123
2 * σ / μ 0.0509%
95% Confidence Intervall ( μ ± 2σ ) ( 30295.47 - 30326.32 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 30287.76 - 30334.04 )
Sample Data
σ 771.2258
Minimum 27758.50
Maximum 33448.13
Spread ( max - min ) 5689.63
Range ( max - min ) / 2 2844.82
Range% 9.39
10th Percentile 29372.60
90th Percentile 31347.40
( 90th Percentile - 10th Percentile ) 1974.80
Approx. Iterations needed for
1% dps error 25
0.1% dps error 2589
0.1 scale factor error with delta=300 5287
0.05 scale factor error with delta=300 21148
0.01 scale factor error with delta=300 528701
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 focus_magic
3 arcane_brilliance
4 mage_armor
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
A volcanic_potion,if=!in_combat
B volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
C arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
D mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
E mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
F flame_orb,if=target.time_to_die>=10
G presence_of_mind,arcane_blast
H arcane_blast,if=target.time_to_die<60&mana_pct>4
I arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
J evocation,invulnerable=1
K evocation,if=target.time_to_die>=31
L sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
M arcane_missiles
N arcane_barrage,if=buff.arcane_blast.stack>0
O arcane_barrage,moving=1
P fire_blast,moving=1
Q ice_lance,moving=1
R restart_sequence,name=conserve

Sample Sequence

0124A9CEGFIIIDIIIIIIIIIIIIIIIIIIIIIIIIIIIIKLLLLLMRLLLLLMRLL9FLLLMRLLLLLMRLLLLLNMRLLLGLLNMRLLLLLNRLLLLLMRLLIIBCII9FIIDIIIIIIIIIIIIIIIIIIIIILLLMKMRLLLLLMRLLE9FGLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMRLLLLLMFIIII9CD7IIIIIIIIIIIIIIIIIIIGIIIIMIIIIKMRLLLFLLM9RLLLLLMRLLLLLMRLLLLLNRLLLLLMRLLLLLMRLLLLLMRLLFGLLLMRLIII9CDEIIIIIIIIIIIIIIIIIIIIIIIIIILLLKLMFMRLLLLLM9RLLLLLMRLLLLLMRLGLLLLMRLLLLLMRLLLLLMRLLLFHHHHHHHHCDH9HHHHHHHHHHHHHHHHHHHHHHHHHHHMHHHHHM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 631 52 20
Agility 648 68 20
Stamina 7658 6035 5972
Intellect 6116 5416 4957
Spirit 291 291 101
Health 143995 121343 0
Mana 113691 103280 0
Spell Power 9145 7613 2207
Spell Hit 15.63% 15.63% 1601
Spell Crit 24.20% 15.12% 514
Spell Haste 20.14% 14.42% 1420
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 673 32 0
Melee Hit 13.33% 13.33% 1601
Melee Crit 14.56% 6.66% 514
Melee Haste 11.09% 11.09% 1420
Expertise 0.00 0.00 0
Armor 12578 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.05% 17.05% 1622

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 3
Invocation 2
Improved Arcane Missiles 2
Improved Blink 0
Arcane Flows 2
Presence of Mind 1
Missile Barrage 2
Prismatic Cloak 3
Improved Polymorph 0
Arcane Tactics 1
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 2
Slow 1
Nether Vortex 2
Focus Magic 1
Improved Mana Gem 2
Arcane Power 1
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 2
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Arcane_T11_372
origin="http://chardev.org/?profile=35357"
level=85
race=gnome
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3033220212301002121212302000000000000000000300000000000000000
glyphs=evocation/arcane_power/slow/mirror_image/arcane_brilliance/conjuring/arcane_blast/arcane_missiles/mage_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/focus_magic
actions+=/arcane_brilliance
actions+=/mage_armor
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,if=cooldown.evocation.remains<44&target.time_to_die>20&mana_gem_charges=0
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/use_item,name=shard_of_woe,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|cooldown.evocation.remains>90|target.time_to_die<40
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=cooldown.evocation.remains<40&buff.arcane_blast.stack=4
actions+=/arcane_power,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mana_gem,if=(cooldown.evocation.remains<40&buff.arcane_blast.stack=4)|target.time_to_die<40
actions+=/mirror_image,if=buff.arcane_power.up|(cooldown.arcane_power.remains>20&target.time_to_die>15)
actions+=/flame_orb,if=target.time_to_die>=10
actions+=/presence_of_mind,arcane_blast
actions+=/arcane_blast,if=target.time_to_die<60&mana_pct>4
actions+=/arcane_blast,if=cooldown.evocation.remains<40&mana_pct>26
actions+=/evocation,invulnerable=1
actions+=/evocation,if=target.time_to_die>=31
actions+=/sequence,name=conserve:arcane_blast:arcane_blast:arcane_blast:arcane_blast:arcane_blast,if=!buff.bloodlust.up
actions+=/arcane_missiles
actions+=/arcane_barrage,if=buff.arcane_blast.stack>0
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1
actions+=/restart_sequence,name=conserve
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_mastery,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=67int_20hit_20int_20int,enchant=20all
waist=soul_breath_belt_of_the_feverflare,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180mastery,reforge=haste_hit,gems=67int_67int,suffix=230
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_mastery,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=spi_hit,gems=40int,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143mastery_143hit,suffix=114
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=haste_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=shard_of_woe,heroic=1,ilevel=379,quality=epic,use=1935haste_10dur_60cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110mastery_110hit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=114
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_mastery,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5972
# gear_intellect=4957
# gear_spirit=101
# gear_spell_power=2207
# gear_hit_rating=1601
# gear_crit_rating=514
# gear_haste_rating=1420
# gear_mastery_rating=1622
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# trinket2=shard_of_woe,heroic=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_flameblaze,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_Frostfire_T11_372 : 25035dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25035.1 21.05 / 0.08% 27.0 928.7 793.2 mana 0.00% 39.4
Origin http://chardev.org/?profile=88851
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • frostfire
  • pyroblast
  • molten_armor

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:55668|43870|39736|14226|9138|944&chds=0,111336&chco=C41F3B,C41F3B,C41F3B,2459FF,C41F3B,2459FF&chm=t++55668++flame_orb,C41F3B,0,0,15|t++43870++living_bomb,C41F3B,1,0,15|t++39736++pyroblast_hs,C41F3B,2,0,15|t++14226++frostfire_bolt,2459FF,3,0,15|t++9138++scorch,C41F3B,4,0,15|t++944++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:47,15,14,9,7,4,2,1,0,0,0,0&chds=0,100&chco=2459FF,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=frostfire_bolt|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:p24678777666544433322221110zzzzyyyxxxxwwvvvvuuuuuttttssssrrrrrrqqqppppooooonnnmmlllllllkkkkjjiiiiiiihhhhggggffffffeeeddddcdeghiihhgggggfffffeedddddccccccbbbaaaaaZZZZZYYYXXXXXWWWWWVVUUTTTTSSSSRRQQQQPPPPPPOOONNNNMMMMMMLLLKKKKJJJJJJIIIHHHHHGGGGGGGIJKKKKKKKJJJJIIIHHHHHHGGGGFFFFFFFEEEEEEEDDDDDDDDEDDDDDDDEEEEEEEEEEEEEEEFFFFFFFFFFFGGGGGHHHHHHIIIIIJJJJJJJJJJKKKKKKKKKKKKKKKKKKKKLLLLLLMMMMMMMNNNNNNOOOOOOOOOPPPPPPPPPPQQQQQQQQRRRRRRSSSSSTTTTTTUUUUUUUUUUUVVVVVV&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=114118&chtt=Mage_Fire_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:jmqqstvwxyy125687655310xwutrqomljiggeedddddccbaaaaaaabbbbbaaaaaaaaabbbaZZYYXXYYYYYXXXWWWWVWWXXYYYYYYYYYZZaaaaaZZZZYYYYYYYYYYYYYZZabbbcccccddeefffffffeeeeddeedddccbbaaaaaaZZZZYYYYYZabbccddeeeffggghgggffedccbbaaZZYXXXXXXXXXXXXXXXXXXXYYYYZZZZZZZZaaabbbbcccccccccdddddcccccccccccccccccccccccccccbbbbbbbaaaZZZZYYZZZZZaaaaaaaaabbbbbbbbbbbbbbbbbbbbbaaaaaaZZZZZZYYYZZZaabbcddeffghijjkkkkkkjjjjiihggffeddccccbbbbbbaaaabbbbbbbccccddddeeeeefffffffffeeedddddddddcc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25035|max=51682&chxp=1,1,48,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,1,6,11,13,27,34,64,70,104,130,169,192,265,329,376,450,492,552,576,585,590,573,546,553,492,444,459,372,321,247,213,163,136,105,95,73,49,32,34,15,7,14,8,3,2,2,1,0,1&chds=0,590&chbh=5&chxt=x&chxl=0:|min=21618|avg=25035|max=29419&chxp=0,1,44,100&chtt=Mage_Fire_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_Frostfire_T11_372 25035
combustion 1792 7.2% 3.8 130.83sec 215035 0 8187 16918 22761 31.0% 0.1% 0.0% 0.0% 52 11058 22896 31.0% 0.0% 8.4%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.77 3.77 52.19 52.19 0.0000 0.7260 809844
Direct Results Count Pct Average Min Max Total Damage
hit 2.6 68.89% 8187.31 7082 11077 21243
crit 1.2 30.99% 16918.32 14552 22761 19744
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 36.0 68.96% 11057.81 3771 26954 397937
crit 16.2 31.04% 22895.89 7749 55386 370920

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:11290.33
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.2 46.35sec 3071 0 2618 4046 4411 32.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.19 10.19 0.00 0.00 0.0000 0.0000 31291
Direct Results Count Pct Average Min Max Total Damage
hit 6.9 67.82% 2617.81 2562 2855 18088
crit 3.3 32.03% 4045.73 3959 4411 13203
miss 0.0 0.14% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
flame_orb 1068 4.3% 7.7 61.12sec 62880 55668 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 114.84 0.00 1.1295 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.19sec 7185 0 5462 11214 14678 30.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 0.00 0.00 0.0000 0.0000 55073
Direct Results Count Pct Average Min Max Total Damage
hit 5.4 69.85% 5461.72 4925 7143 29243
crit 2.3 30.05% 11214.28 10121 14678 25830
miss 0.0 0.10% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 946 3.8% 114.8 3.70sec 3723 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2816 5812 30.4% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.84 0.00 0.00 114.84 0.0000 0.0000 427541
Tick Results Count Pct Average Min Max Total Damage
hit 79.8 69.49% 2816.49 2437 3859 224771
crit 34.9 30.38% 5811.89 5008 7930 202770
miss 0.1 0.12% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
frostfire_bolt 11683 46.7% 211.5 2.12sec 24971 14226 18526 38143 53980 30.3% 0.1% 0.0% 0.0% 194 489 1007 30.3% 0.0% 98.6%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
211.49 210.83 193.87 193.87 1.7553 2.2980 5281062
Direct Results Count Pct Average Min Max Total Damage
hit 146.6 69.54% 18526.17 16101 26270 2716090
crit 64.0 30.34% 38142.75 33086 53980 2439705
miss 0.3 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 135.1 69.70% 489.27 253 691 66116
crit 58.7 30.30% 1007.04 544 1420 59150

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:434.26
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
ignite 3657 14.6% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 155 10677 0 0.0% 0.0% 68.5%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 104.32 154.83 154.83 0.0000 2.0000 1653072
Direct Results Count Pct Average Min Max Total Damage
hit 104.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 154.8 100.00% 10676.76 915 48216 1653072

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:15529.52
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4056 16.2% 35.8 12.82sec 51211 43870 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6546 13487 30.3% 0.0% 93.2%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.80 35.80 186.19 186.19 1.1673 2.2639 1611067
Direct Results Count Pct Average Min Max Total Damage
hit 35.8 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.7 69.65% 6546.30 5492 10706 848954
crit 56.5 30.35% 13487.15 11286 21999 762113

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 491 2.0% 35.8 12.67sec 6213 0 4722 9722 13597 29.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.75 35.75 0.00 0.00 0.0000 0.0000 222129
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 69.94% 4722.42 4154 6617 118094
crit 10.7 29.93% 9722.41 8536 13597 104036
miss 0.0 0.13% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2258 9.0% 22.0 19.89sec 46376 39736 21904 45077 63645 40.4% 0.1% 0.0% 0.0% 100 2358 4855 40.4% 0.0% 50.4%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.01 21.92 99.81 99.81 1.1671 2.2818 1020545
Direct Results Count Pct Average Min Max Total Damage
hit 13.0 59.51% 21904.09 19113 30973 285728
crit 8.8 40.36% 45076.72 39274 63645 398839
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 59.5 59.61% 2357.50 1985 3866 140256
crit 40.3 40.39% 4854.89 4079 7944 195722

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 3 0.0% 0.1 5.31sec 11206 9138 8748 17985 22224 26.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.14 0.14 0.00 0.00 1.2263 0.0000 1516
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 73.39% 8748.05 7718 11313 869
crit 0.0 26.61% 17985.29 15859 22224 647

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 571
mirror_fire_blast 117 20.5% 34.3 33.52sec 1215 0 1168 1753 2093 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.27 34.27 0.00 0.00 0.0000 0.0000 41627
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.08% 1168.48 1105 1395 35673
crit 3.4 9.91% 1753.03 1658 2093 5954
miss 0.3 1.01% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 454 79.5% 85.7 12.82sec 1888 944 2018 3026 3594 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.68 77.11 0.00 0.00 2.0000 0.0000 161733
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.07% 2017.74 1912 2396 138588
crit 7.6 9.92% 3026.17 2868 3594 23146
miss 0.8 1.01% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_Frostfire_T11_372
flame_orb mana 1.8% 65.4 961
frostfire_bolt mana 74.2% 17.0 1473
living_bomb mana 23.1% 18.9 2708
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29482.4 16.3 0.0%
clearcasting none 25.2 39690.7 1577.7 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 645.0 114395.5 177.4 0.0%
mana_gem mana 3.0 36312.0 12104.0 0.0%
master_of_elements mana 109.6 40210.8 367.0 0.0%
mp5_regen mana 1808.8 78669.5 43.5 0.0%
replenishment mana 1808.8 53610.9 29.6 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 212.4 0.0 2.1sec 2.1sec 81% 81%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 22.1 1.1 19.9sec 18.9sec 9% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.2 0.0 51.7sec 51.7sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 36% 36%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.1 0.0 480.4sec 480.4sec 64% 65%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.0 0.0 47.4sec 47.4sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.1sec 115.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.3sec 414.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.8sec
munched_ignite 19.8 21.6sec
rolled_ignite 8.4 46.3sec

Statistics & Data Analysis

DPS
Population
Convergence 70.04%
σ of the average dps 10.5241
2 * σ / μ 0.0841%
95% Confidence Intervall ( μ ± 2σ ) ( 25014.03 - 25056.12 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25003.50 - 25066.65 )
Sample Data
σ 1052.4062
Minimum 21617.59
Maximum 29419.41
Spread ( max - min ) 7801.82
Range ( max - min ) / 2 3900.91
Range% 15.58
10th Percentile 23744.96
90th Percentile 26427.96
( 90th Percentile - 10th Percentile ) 2683.00
Approx. Iterations needed for
1% dps error 70
0.1% dps error 7068
0.1 scale factor error with delta=300 9844
0.05 scale factor error with delta=300 39379
0.01 scale factor error with delta=300 984496
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I frostfire_bolt
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138AFEHIIBIIIIIIFIIIIIIIIIFIIIIIIIIIFIIIIGIDIFGIIIIGHFIIIIIIFIIIIIIFIIIIIIFGIIIIIIFIIIIIBHIFIIIIIIFIIIIIIFGIIIIGIFIIIIDIIFIAIEGIHIIFGIIIIGIFIIGIIIIFGIIIIIIFIIIIIIFGIIBHIIIFIIIIIIFIIIIGIIFIIIIIGIFIDIIIIIIJHIFKIIIGIIFIIIIGIIFIIIIIIFIIIIIIAFIEIIIHIIFIIIGIIIFIIGIIGIFIIIGIIIFGIIIIIIFDGIHIIIGFIIIGIIGFIIIIIIFGIIIIIIFGIIIIIGFIHIIIIIFII9IIIIFIIIIIIFGIIGIIIFIAI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_Frostfire_T11_372
origin="http://chardev.org/?profile=88851"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/frostfire/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/frostfire_bolt
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Fire_T11_372 : 25917dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25917.0 20.71 / 0.08% 28.2 918.9 781.5 mana 0.00% 39.6
Origin http://chardev.org/?profile=88793
Talents http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
Glyphs
  • evocation
  • dragons_breath
  • mana_shield
  • conjuring
  • arcane_brilliance
  • slow_fall
  • fireball
  • pyroblast
  • molten_armor

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:55695|43929|39272|14440|9231|945&chds=0,111390&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF&chm=t++55695++flame_orb,C41F3B,0,0,15|t++43929++living_bomb,C41F3B,1,0,15|t++39272++pyroblast_hs,C41F3B,2,0,15|t++14440++fireball,C41F3B,3,0,15|t++9231++scorch,C41F3B,4,0,15|t++945++mirror_frost_bolt,2459FF,5,0,15&chtt=Mage_Fire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x320&cht=p&chf=bg,s,333333&chd=t:45,16,14,10,7,4,2,1,0,0,0,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,2459FF,C41F3B,C41F3B,C41F3B,C41F3B&chl=fireball|ignite|living_bomb|pyroblast_hs|combustion|flame_orb_tick|living_bomb_explosion|mirror_frost_bolt|flame_orb_explosion|mirror_fire_blast|darkmoon_card_volcano|scorch&chtt=Mage_Fire_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:p246777776665444333322221100zzzzyyyyxxxwvvvvvvvuuuuuttssssssssrrrrqqppppppoooonnmmmmmmlllllkkjjjjjjjiiiihhhhhggggggffeeeeeeghjjjjiihhhhhhggggfffeeeeeeeddddcccbbbbbbbaaaZZZZZYYYYYYXXWWVVVUUUUUTTSSSSRRRRRRQQQPPPPPOOOOOONNNMMMMMLLLLLKKKKJJJJJJIIIJKLMNNMMMMMLLLLKKKKJJJJJIIIIHHHHHGGGGGFFFFFEEEEEEEEEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEEEEEFFFFFFGGGGGHHHHHHHHIIIIIIIJJJJJIJJJJJJJJJJJJKKKKKKLLLLLLMMMMMMMNNNNNNNNOOOOOOOOOPPPPPPPPQQQQQQRRRRRSSSSSSTTTTTTTTTUUUUU&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=114166&chtt=Mage_Fire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:ilopssuvxyy02567776531zywutrpnlkihffedcccccbbbaaZZZZZaabaaaaaaZZZZaaaaaZZYYXXXXXYXXXWWWWVVVWWXXXXXXXXYYYZZZaZZZZZYYYYYYYYYYYYYZZZabbcccccdddeeefffffeeddddddddcccbaaaZZZZZZZYYYYYXYYYZabbcccddeeeffffffeedccbbaaZZYYXXXWWWWWXXXXXXWWWXXXXYYYYYYYYYZZaaabbcccccccddddeeeeddddddccccccccbbbccccccccccbbbbbbbaaaZZZYYYYYYYZZZZZZZZZZZaaaaaaaaaaaaaaaaaaaaaaaaaZZZZZZZYYYZZZaaabbcddeffghiijjjkkkjjjjjiihhggffeedddccccbbbbbaaaaaaabbbbbbbcccccdddddeeeeeeedddddddddddc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=25917|max=54293&chxp=1,1,48,100&chtt=Mage_Fire_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:4,2,10,8,11,21,37,59,78,115,153,228,289,349,411,466,563,618,643,661,620,668,652,546,468,486,421,292,290,193,167,134,113,63,48,28,30,18,10,10,3,5,4,1,3,0,0,0,0,1&chds=0,668&chbh=5&chxt=x&chxl=0:|min=22433|avg=25917|max=30985&chxp=0,1,41,100&chtt=Mage_Fire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Fire_T11_372 25917
combustion 1835 7.1% 3.9 127.78sec 213611 0 8214 16987 22761 31.2% 0.1% 0.0% 0.0% 54 10951 22648 31.3% 0.0% 8.6%

Stats details: combustion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.88 3.88 53.85 53.85 0.0000 0.7246 829515
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 68.74% 8214.20 7082 11077 21928
crit 1.2 31.16% 16986.55 14552 22761 20554
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 37.0 68.68% 10951.27 3828 25412 405062
crit 16.9 31.32% 22647.54 7866 52218 381971

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Combines your damaging periodic Fire effects on an enemy target but does not consume them, instantly dealing $s2 Fire damage and creating a new periodic effect that lasts $83853d and deals damage per time equal to the sum of the combined effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:954.57
  • base_dd_max:1131.92
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10033.48
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
darkmoon_card_volcano 69 0.3% 10.1 46.71sec 3071 0 2616 4041 4411 32.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.12 10.12 0.00 0.00 0.0000 0.0000 31077
Direct Results Count Pct Average Min Max Total Damage
hit 6.8 67.69% 2616.11 2562 2855 17917
crit 3.3 32.18% 4041.44 3959 4411 13161
miss 0.0 0.13% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
fireball 11702 45.2% 208.6 2.15sec 25348 14440 18521 38120 53999 35.4% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
208.65 207.89 0.00 0.00 1.7554 0.0000 5288717
Direct Results Count Pct Average Min Max Total Damage
hit 134.0 64.47% 18521.36 16106 26279 2482393
crit 73.6 35.41% 38119.88 33096 53999 2806325
miss 0.2 0.12% 0.00 0 0 0

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1567.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.124000
  • base_dd_min:898.89
  • base_dd_max:1146.36
flame_orb 1068 4.1% 7.7 61.15sec 62938 55695 0 0 0 0.0% 0.1% 0.0% 0.0% 115 0 0 0.0% 0.0% 25.4%

Stats details: flame_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.67 7.67 114.77 0.00 1.1300 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb

Static Values
  • id:82731
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1045.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Flame Orb forward from the Mage's position, dealing $82739s1 Fire damage every second to the closest enemy target for 15 secs$?s54734[, and exploding for $83619s1 at the end of its duration][]$?s18460[, with a $18460h% chance to explode for $83619s1 at the end of its duration][]$?s18459[, with a $18459h% chance to explode for $83619s1 at the end of its duration][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
flame_orb_explosion 122 0.5% 7.7 61.19sec 7190 0 5470 11219 14678 30.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_orb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.66 7.66 0.00 0.00 0.0000 0.0000 55075
Direct Results Count Pct Average Min Max Total Damage
hit 5.3 69.83% 5469.67 4925 7143 29256
crit 2.3 30.04% 11219.19 10121 14678 25819
miss 0.0 0.13% 0.00 0 0 0

Action details: flame_orb_explosion

Static Values
  • id:83619
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:At the end of its duration your Flame Orb explodes, dealing $s1 Fire damage to all nearby enemies.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.193000
  • base_dd_min:1134.10
  • base_dd_max:1336.70
flame_orb_tick 946 3.7% 114.8 3.71sec 3726 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2817 5806 30.5% 0.1% 0.0%

Stats details: flame_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
114.77 0.00 0.00 114.77 0.0000 0.0000 427620
Tick Results Count Pct Average Min Max Total Damage
hit 79.6 69.34% 2816.52 2437 3859 224145
crit 35.0 30.54% 5805.57 5008 7930 203475
miss 0.1 0.12% 0.00 0 0 0

Action details: flame_orb_tick

Static Values
  • id:82739
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:69.7
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ignite 4064 15.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 164 11188 0 0.0% 0.0% 72.7%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 115.22 164.18 164.18 0.0000 2.0000 1836902
Direct Results Count Pct Average Min Max Total Damage
hit 115.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 164.2 100.00% 11188.20 915 44442 1836902

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:18658.33
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
living_bomb 4050 15.6% 35.7 12.85sec 51267 43929 0 0 0 0.0% 0.1% 0.0% 0.0% 186 6545 13479 30.5% 0.0% 93.0%

Stats details: living_bomb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.70 35.70 185.83 185.83 1.1670 2.2628 1609108
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.2 69.51% 6544.72 5492 10706 845391
crit 56.7 30.49% 13478.77 11286 21999 763718

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $s1 Fire damage every $t1 sec. After $d, the target explodes causing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
  • description:The target becomes a Living Bomb, taking $o1 Fire damage over $d. After $d, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards. Limit 3 targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.233000
  • base_td:403.05
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
living_bomb_explosion 489 1.9% 35.7 12.70sec 6202 0 4714 9702 13597 29.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: living_bomb_explosion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
35.66 35.66 0.00 0.00 0.0000 0.0000 221138
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 69.92% 4713.81 4154 6617 117527
crit 10.7 29.95% 9702.34 8536 13597 103610
miss 0.0 0.13% 0.00 0 0 0

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:2961.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:The target becomes a Living Bomb, taking $44457o1 Fire damage over $44457d. After $44457d or if the spell is reapplied, the target explodes dealing $44461s1 Fire damage to up to 3 enemies within $44461a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.233000
  • base_dd_min:403.05
  • base_dd_max:403.05
pyroblast_hs 2675 10.3% 26.4 16.72sec 45834 39272 21879 45036 63645 40.3% 0.1% 0.0% 0.0% 116 2356 4845 40.5% 0.0% 58.5%

Stats details: pyroblast_hs

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.38 26.28 115.78 115.78 1.1671 2.2835 1209074
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 59.57% 21878.70 19113 30973 342550
crit 10.6 40.30% 45036.26 39274 63645 477065
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 68.9 59.52% 2356.25 1985 3866 162378
crit 46.9 40.48% 4844.85 4079 7944 227081

Action details: pyroblast_hs

Static Values
  • id:92315
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$s2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.305000
  • base_dd_min:1300.62
  • base_dd_max:1651.97
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.087000
  • base_td:220.27
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
scorch 4 0.0% 0.2 4.20sec 11307 9231 8819 18108 24288 26.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: scorch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.16 0.16 0.00 0.00 1.2249 0.0000 1761
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 73.22% 8819.33 7718 11321 1005
crit 0.0 26.78% 18108.04 15859 24288 755

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:-0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Scorch the enemy for $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.512000
  • base_dd_min:669.83
  • base_dd_max:794.28
pet - mirror_image_3 571
mirror_fire_blast 117 20.5% 34.3 33.52sec 1216 0 1169 1754 2095 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.27 34.27 0.00 0.00 0.0000 0.0000 41663
Direct Results Count Pct Average Min Max Total Damage
hit 30.6 89.17% 1169.43 1105 1397 35741
crit 3.4 9.85% 1753.70 1658 2095 5922
miss 0.3 0.97% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 454 79.5% 85.7 12.82sec 1889 945 2019 3028 3598 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.68 77.11 0.00 0.00 2.0000 0.0000 161883
Direct Results Count Pct Average Min Max Total Damage
hit 68.7 89.09% 2019.29 1912 2398 138731
crit 7.6 9.91% 3028.20 2868 3598 23152
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29

Resources

Resource Usage Type Res% DPR RPE
Mage_Fire_T11_372
fireball mana 73.9% 17.2 1471
flame_orb mana 1.8% 65.6 960
living_bomb mana 23.3% 18.9 2714
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29479.5 16.3 0.0%
clearcasting none 25.1 39565.1 1573.9 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101753.0 101753.0 0.0%
mage_armor mana 590.2 104571.7 177.2 0.0%
mana_gem mana 3.0 36303.6 12101.2 0.0%
master_of_elements mana 119.4 44774.3 374.8 0.0%
mp5_regen mana 1808.8 78662.1 43.5 0.0%
replenishment mana 1808.8 53563.9 29.6 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.8sec 180.8sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 209.6 0.0 2.1sec 2.1sec 79% 79%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
clearcasting 25.2 0.0 18.2sec 18.2sec 7% 7%

Database details

  • id:
  • cooldown name:buff_clearcasting
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:15.00
  • default_chance:40.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
hot_streak 26.5 1.5 16.7sec 15.8sec 11% 100%

Database details

  • id:48108
  • cooldown name:buff_hot_streak
  • tooltip:Your next Pyroblast spell is instant cast and costs no mana.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
lightweave_embroidery 9.1 0.0 52.1sec 52.1sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.0 0.0 0.0sec 0.0sec 33% 33%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.0 0.0 507.0sec 507.0sec 67% 68%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 48.1sec 48.1sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.3 0.0 115.0sec 115.0sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.3sec 414.3sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.8 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%

Procs

Count Interval
mana_gem 3.0 120.8sec
munched_ignite 23.8 18.2sec
rolled_ignite 7.4 50.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.56%
σ of the average dps 10.3525
2 * σ / μ 0.0799%
95% Confidence Intervall ( μ ± 2σ ) ( 25896.32 - 25937.73 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.92% - 100.08% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25885.97 - 25948.08 )
Sample Data
σ 1035.2520
Minimum 22432.95
Maximum 30985.46
Spread ( max - min ) 8552.50
Range ( max - min ) / 2 4276.25
Range% 16.50
10th Percentile 24646.63
90th Percentile 27275.43
( 90th Percentile - 10th Percentile ) 2628.79
Approx. Iterations needed for
1% dps error 63
0.1% dps error 6382
0.1 scale factor error with delta=300 9526
0.05 scale factor error with delta=300 38106
0.01 scale factor error with delta=300 952663
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 snapshot_stats
6 counterspell
7 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
8 volcanic_potion,if=!in_combat
9 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
A berserking
B mana_gem,if=mana_deficit>12500
C scorch,debuff=1
D combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
E mirror_image,if=target.time_to_die>=25
F living_bomb,if=!ticking
G pyroblast_hs,if=buff.hot_streak.react
H flame_orb,if=target.time_to_die>=12
I fireball
J mage_armor,if=mana_pct<5&buff.mage_armor.down
K scorch

Sample Sequence

0138AFEBHIIIGIDIIIFGIIIIIGIIFIIIIIIIIIFIIIIIIIFIIIIIHIFGIIIIGIFIIIIIGIFIIIIIIFGIIIGIIFIIGBIHGIFDIIIGIIIFIIIIIIFIIIIIIFIIIGIIIAFEIIHIIIIFIIIIIIFIIIGIIGFIIIIIIFGIIGIIIFBIHIIIIIFIIIIIIFGIDIIGIIFIIIGIIIFIIIIIGIFHIIIIGIIIFGIJIIGIFIIGIIIIFIIIIIIAFEIIIIGHIFIIIIIGIFIIIGDIIIFIIIIGIIFIIIIIIFGIIGHIIFIIIIIIFGIIIGIIFIIIIIIFGIIIIIIFIIIHIIGFIII9GIIIFDIIIGIIIFIIGIIIIFAII

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6071 5373 4923
Spirit 212 212 21
Health 143673 121035 0
Mana 107603 97718 0
Spell Power 9095 7570 2207
Spell Hit 16.88% 16.88% 1729
Spell Crit 27.55% 16.48% 769
Spell Haste 26.09% 20.08% 2124
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.40% 14.40% 1729
Melee Crit 15.99% 8.08% 769
Melee Haste 16.59% 16.59% 2124
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.23% 13.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
shirt empty
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Arcane Rank
Arcane Concentration 3
Improved Counterspell 0
Netherwind Presence 3
Torment the Weak 0
Invocation 1
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 1
Ignite 3
Fire Power 3
Blazing Speed 0
Impact 2
Cauterize 2
Blast Wave 0
Hot Streak 1
Improved Scorch 2
Molten Shields 0
Combustion 1
Improved Hot Streak 2
Firestarter 1
Improved Flamestrike 0
Dragon's Breath 1
Molten Fury 3
Pyromaniac 0
Critical Mass 3
Living Bomb 1
Frost Rank
Early Frost 0
Piercing Ice 3
Shatter 0
Ice Floes 0
Improved Cone of Cold 0
Piercing Chill 0
Permafrost 0
Ice Shards 0
Icy Veins 0
Fingers of Frost 0
Improved Freeze 0
Enduring Winter 0
Cold Snap 0
Brain Freeze 0
Shattered Barrier 0
Ice Barrier 0
Reactive Barrier 0
Frostfire Orb 0
Deep Freeze 0

Profile

#!./simc

mage=Mage_Fire_T11_372
origin="http://chardev.org/?profile=88793"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#mage-3030100000000000000002313302201201210130310300000000000000000
glyphs=evocation/dragons_breath/mana_shield/conjuring/arcane_brilliance/slow_fall/fireball/pyroblast/molten_armor
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking
actions+=/mana_gem,if=mana_deficit>12500
actions+=/scorch,debuff=1
actions+=/combustion,if=dot.living_bomb.ticking&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/living_bomb,if=!ticking
actions+=/pyroblast_hs,if=buff.hot_streak.react
actions+=/flame_orb,if=target.time_to_die>=12
actions+=/fireball
actions+=/mage_armor,if=mana_pct<5&buff.mage_armor.down
actions+=/scorch
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=50int_25haste
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=67int_67int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_67int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4923
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1729
# gear_crit_rating=769
# gear_haste_rating=2124
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_Frostfire_T11_372 : 25942dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25942.3 12.39 / 0.05% 28.8 900.9 755.5 mana 0.02% 42.8
Origin http://chardev.org/?profile=87205
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • ice_lance
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:78944|35454|33967|24044|13620|2426|986&chds=0,157889&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++78944++deep_freeze,2459FF,0,0,15|t++35454++frostfire_orb,2459FF,1,0,15|t++33967++ice_lance,2459FF,2,0,15|t++24044++frostbolt,2459FF,3,0,15|t++13620++frostfire_bolt,2459FF,4,0,15|t++2426++water_bolt,2459FF,5,0,15|t++986++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_Frostfire_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:36,24,13,9,7,6,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostfire_bolt|ice_lance|deep_freeze|water_bolt|ignite|frostbolt|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_Frostfire_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:p35677877766665554433222111100000zzzyyxxxwwwwwvvvvuuutttttssssrrrrqqqppppoooonnnnnmmmmllllkkkkkkkjjjjiiiiihhhhhhggggggfffffhjjkkkjjjjjiiiiihhhhhhhhgggggfffffeeeeedddddcccccbbbbbbaaaaZZYYYYXXXXXWWWWWWVVVVVUUUUUUTTTTSSSRRRRRQQQQPPPPOOONNNNNNMMMMNPQRSSRRRRRRRRQQQQQQQQQPPPPPPPOOOOOOOOONNNNNNNNMMMMMMMMMMMMMMMLLLLLLLLLLLLLLLLLLLLMMMMMMMMNNNNNNNOOOOOOOPPPPPPPPPPPPPPPPPPPPQQQQQQQQQQRRRRRRRSSSSSSTTTTTTUUUUUUUUUVVVVVVVVVVWWWWWWWWWXXXXXXXXXYYYYYYYYYYZZZZZZZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=115212&chtt=Mage_Frost_Frostfire_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:2457677765476813221zyxuwwusrppoommlljjjiijkmihijjjjkkmprstttuvvtssstuuvwwwusqpooonmlljjkjjjihihiiijjkjkkkkkkjihhhgffeeeefefghijkklkllllllllkkjjjiihgggghhhiijjjjjjjjiihhhgfeeddcccddfghjklmnpqrstttttssrqpnmlkkjjiihihiijjjkklkllkkjjjjiihhhghggghiijklllmmmmmmmllllllkjjihggfffeffggghghghggghhhiiiiihggffeeeeeeffgggghhhiijjkjkkkkjjjihhgggffffffffgggghghhhhhhhhggggggggghijklmoprstuvvvwvvvutsrqpnmkihfeeedddedeeeeefefeeeefeeeeddeeefgghijkklmmmnnnnooopppoonn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=25942|max=42032&chxp=1,1,62,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,2,2,5,9,15,29,35,51,77,98,141,170,224,284,315,403,466,492,596,589,628,556,627,598,506,472,445,416,365,315,256,206,148,112,94,69,60,40,27,21,11,7,4,9,1,1,2&chds=0,628&chbh=5&chxt=x&chxl=0:|min=23606|avg=25942|max=28342&chxp=0,1,49,100&chtt=Mage_Frost_Frostfire_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_Frostfire_T11_372 25942
cold_snap 0 0.0% 1.5 386.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.49 1.49 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 68 0.3% 10.1 47.00sec 3067 0 2608 4033 4411 33.3% 0.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.06 10.06 0.00 0.00 0.0000 0.0000 30857
Direct Results Count Pct Average Min Max Total Damage
hit 6.6 66.10% 2608.27 2562 2855 17343
crit 3.4 33.31% 4032.56 3959 4411 13514
miss 0.1 0.59% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3290 12.7% 16.1 28.79sec 92547 78944 42862 94371 150279 96.9% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.06 16.06 0.00 0.00 1.1723 0.0000 1486741
Direct Results Count Pct Average Min Max Total Damage
hit 0.4 2.57% 42861.69 39611 62781 17702
crit 15.6 96.90% 94370.60 81395 150279 1469039
miss 0.1 0.53% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 1480 5.7% 27.7 16.48sec 24191 24044 18212 37675 49569 31.6% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.66 27.57 0.00 0.00 1.0061 0.0000 669017
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 67.85% 18212.42 16543 24123 340662
crit 8.7 31.61% 37675.28 33993 49569 328355
miss 0.1 0.54% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.943000
  • base_dd_min:728.34
  • base_dd_max:928.86
frostfire_bolt 9244 35.6% 175.5 2.55sec 23813 13620 17163 35964 69693 32.7% 0.5% 0.0% 0.0% 192 459 948 32.4% 0.0% 97.9%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
175.45 174.88 191.55 191.55 1.7484 2.3092 4178089
Direct Results Count Pct Average Min Max Total Damage
hit 116.8 66.79% 17163.04 15631 29432 2004563
crit 57.1 32.68% 35963.59 32119 69693 2055226
miss 0.9 0.54% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 129.5 67.58% 459.19 184 784 59444
crit 62.1 32.42% 947.89 377 1612 58857

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:376.40
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 831 3.2% 9.0 51.52sec 41807 35454 0 0 0 0.0% 0.5% 0.0% 0.0% 123 0 0 0.0% 0.0% 27.1%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.98 8.98 122.57 0.00 1.1792 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.52% 0.00 0 0 0
miss 0.0 0.48% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing $95969s2 Frostfire damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 831 3.2% 122.6 3.49sec 3065 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2294 4753 31.8% 0.5% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.57 0.00 0.00 122.57 0.0000 0.0000 375639
Tick Results Count Pct Average Min Max Total Damage
hit 82.9 67.67% 2294.34 2057 2909 190286
crit 39.0 31.82% 4753.05 4228 5977 185353
miss 0.6 0.52% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 6238 24.0% 71.6 6.31sec 39364 33967 0 39647 62227 99.5% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
71.62 71.48 0.00 0.00 1.1589 0.0000 2819194
Direct Results Count Pct Average Min Max Total Damage
crit 71.1 99.48% 39646.65 34174 62227 2819194
miss 0.4 0.52% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1872 7.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 137 6182 0 0.0% 0.0% 60.6%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 86.23 136.86 136.86 0.0000 2.0000 846087
Direct Results Count Pct Average Min Max Total Damage
hit 86.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 136.9 100.00% 6182.24 564 25864 846087

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:8829.57
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 595
mirror_fire_blast 122 20.5% 34.2 33.50sec 1270 0 1223 1833 2414 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.20 34.20 0.00 0.00 0.0000 0.0000 43448
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.08% 1222.64 1105 1610 37250
crit 3.4 9.89% 1833.09 1657 2414 6198
miss 0.4 1.04% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 473 79.5% 85.5 12.81sec 1972 986 2108 3162 4129 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.51 76.96 0.00 0.00 2.0000 0.0000 168652
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.08% 2107.83 1912 2753 144495
crit 7.6 9.93% 3161.57 2867 4129 24157
miss 0.8 0.99% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2452
freeze 27 1.1% 17.0 27.41sec 714 0 540 1078 1169 33.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.00 17.00 0.00 0.00 0.0000 0.0000 12140
Direct Results Count Pct Average Min Max Total Damage
hit 11.1 65.56% 539.84 529 586 6017
crit 5.7 33.39% 1078.48 1055 1169 6123
miss 0.2 1.05% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2425 98.9% 205.6 2.19sec 5325 2426 4042 8117 10627 33.2% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.59 204.48 0.00 0.00 2.1949 0.0000 1094868
Direct Results Count Pct Average Min Max Total Damage
hit 134.5 65.80% 4041.79 3682 5327 543796
crit 67.9 33.20% 8116.88 7346 10627 551072
miss 2.0 1.00% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_Frostfire_T11_372
deep_freeze mana 6.2% 59.1 1567
frostbolt mana 13.8% 11.9 2037
frostfire_bolt mana 59.3% 17.3 1377
frostfire_orb mana 2.1% 44.5 940
ice_lance mana 16.5% 41.9 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29441.3 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 454.6 80811.5 177.8 0.0%
mana_gem mana 3.0 36309.3 12103.1 0.0%
master_of_elements mana 152.9 57017.2 373.0 0.0%
mp5_regen mana 1808.8 78560.4 43.4 0.2%
replenishment mana 1808.8 53462.3 29.6 0.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.9 0.0 188.4sec 188.4sec 6% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 4.2 0.0 82.4sec 82.4sec 0% 2%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 199.7 0.0 2.2sec 2.2sec 70% 70%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 33.6 48.0 13.6sec 5.5sec 77% 98%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.0sec 104.0sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.1 0.0 52.4sec 52.4sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.1 0.0 244.5sec 244.5sec 25% 25%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.4 0.0 403.7sec 403.7sec 75% 76%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 114.1sec 114.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 64.2sec 64.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.7sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.6 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 27.7 16.5sec
mana_gem 3.0 120.9sec
munched_ignite 10.8 38.1sec
rolled_ignite 5.9 59.6sec

Statistics & Data Analysis

DPS
Population
Convergence 70.76%
σ of the average dps 6.1966
2 * σ / μ 0.0478%
95% Confidence Intervall ( μ ± 2σ ) ( 25929.86 - 25954.65 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25923.67 - 25960.85 )
Sample Data
σ 619.6636
Minimum 23605.65
Maximum 28341.89
Spread ( max - min ) 4736.24
Range ( max - min ) / 2 2368.12
Range% 9.13
10th Percentile 25169.47
90th Percentile 26756.63
( 90th Percentile - 10th Percentile ) 1587.16
Approx. Iterations needed for
1% dps error 22
0.1% dps error 2282
0.1 scale factor error with delta=300 3413
0.05 scale factor error with delta=300 13652
0.01 scale factor error with delta=300 341318
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*15)<target.time_to_die
M frostbolt,if=!cooldown.early_frost.remains
N frostfire_bolt
O ice_lance,moving=1
P fire_blast,moving=1

Sample Sequence

01359FJDEBHMJJNNNNJNNJNNMNJNKNJNNNNHMNNNGNNNNNJNKJJMNNNNDJNHCDGHAJMJNNNJKJNNJNMNJNNNNNHNKMNJNNNNNJNMNBNNDJHKNJNJMNJNJNNNNJMJKNHNNNNNMNNNNNFNENKMJDJNHNJNNNMJJNNJNKGNKJJMNNHNNNNJNNMNLNKNKBNJNDJMHNNJNNJNNJKKMJNJNNNNHNMNNNNJKNJNMNNNDJNHNJMNNJKJNNNNJMNJN4NHNNNMJNNGNNJENNNMNDJNNHNFKJNNJMJNNNNNJNNMNJKNHNNJNJMNNJNNNNDKJJMNNNNNNHNCDGHMNNKNNJNJNNMNNNNNNNNHKMJNNNNNNNMNNNLNDNHNKJMNNJNJNNJNMNJN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.47% 16.47% 1687
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.05% 14.05% 1687
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.43% 7.43% 973

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_Frostfire_T11_372
origin="http://chardev.org/?profile=87205"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/ice_lance/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*15) actions+=/frostbolt,if=!cooldown.early_frost.remains
actions+=/frostfire_bolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1687
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=973
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Mage_Frost_T11_372 : 28626dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28626.4 11.08 / 0.04% 22.9 1251.2 1092.5 mana 0.02% 48.7
Origin http://chardev.org/?profile=87885
Talents http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
Glyphs
  • ice_barrier
  • evocation
  • blink
  • slow_fall
  • conjuring
  • arcane_brilliance
  • frostbolt
  • frostfire
  • deep_freeze

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:77655|38966|35657|32310|18256|2405|987&chds=0,155310&chco=2459FF,2459FF,2459FF,2459FF,2459FF,2459FF,2459FF&chm=t++77655++deep_freeze,2459FF,0,0,15|t++38966++frostfire_bolt,2459FF,1,0,15|t++35657++frostfire_orb,2459FF,2,0,15|t++32310++ice_lance,2459FF,3,0,15|t++18256++frostbolt,2459FF,4,0,15|t++2405++water_bolt,2459FF,5,0,15|t++987++mirror_frost_bolt,2459FF,6,0,15&chtt=Mage_Frost_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:44,18,11,10,8,4,3,1,0,0,0&chds=0,100&chco=2459FF,2459FF,2459FF,2459FF,2459FF,C41F3B,2459FF,2459FF,C41F3B,C41F3B,2459FF&chl=frostbolt|ice_lance|deep_freeze|frostfire_bolt|water_bolt|ignite|frostfire_orb_tick|mirror_frost_bolt|mirror_fire_blast|darkmoon_card_volcano|freeze&chtt=Mage_Frost_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:p3567777665544433221100zzyyxxxwwvvuuttssrqqppooonnmmlllkkkjjiihhhhgggffeedddccbbbbaaZZYYYXXXWWWVVVUUUTTTTSSSSSSSSSSSSSRRRRSUWXXXXXXXXWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWWWWWWWWWWWWWWXXXXXXXXXXXXXXXXXXXXXXXXXXXXWWWWWWWWVVVVVVVVVVVXZabcccccccccccccccccccccbbbbbbbbbbbbbaaaaaaaaZZZZZZZZYYYYYYYYYYXXXXXXXXWWWWWWWWWVVVVVVVVVVVVVVUUUUUUUUUUUUUTTTTTTTTTSSSRRRRRRQQQQQQPPPPPPPPPPPPPPOOOOOOOOOOOOOONNNNNNNNNNNNNMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNNNNNN&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=115128&chtt=Mage_Frost_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:13465565544667243320yxvxvusrpponmmlmkkjjjjlmiijjkkkllmopprqrrssrrrrsssttttsrqqpoonnmmllkkkjiiiiiiiijjjjjjjjjiihhgggfffeeeeffgghiiiijjjjjkjkjkjjjiihhggggghhhiiiiiihhhhgggffefedcccddefghijklmnopqpqqqqppoonmlkkjjiihhhhhiiijjkkkkjjjjjiiiiiihihhhhhhiijjjkkkkkkkjjjjjjjiihhhggffffffffffgfggggghhhhihihhhggggffffffgfgggghhhiijijjjjjjjjiiihhhhgggggggghhhhhhhhhihihhhhhhhhiijjklmnoppqrssttttssrrqponmlkihggfffeeeeeeeeeeeeeeeeeeeeeeeeffgghhiijkklllllmmmnnnnnnmm&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=28626|max=46982&chxp=1,1,61,100&chtt=Mage_Frost_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,1,3,2,3,1,15,26,36,44,64,95,125,158,218,288,338,430,481,536,595,673,640,661,647,551,545,557,421,335,346,280,213,182,132,116,77,46,46,35,10,7,8,6,4,0,0,1&chds=0,673&chbh=5&chxt=x&chxl=0:|min=26355|avg=28626|max=30842&chxp=0,1,51,100&chtt=Mage_Frost_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Mage_Frost_T11_372 28626
cold_snap 0 0.0% 1.5 389.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.46 1.46 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.5 100.00% 0.00 0 0 0

Action details: cold_snap

Static Values
  • id:11958
  • school:frost
  • resource:mana
  • tree:frost
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:384.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown on all Frost spells you recently cast.
darkmoon_card_volcano 68 0.2% 10.0 47.35sec 3075 0 2611 4038 4411 32.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.99 9.99 0.00 0.00 0.0000 0.0000 30720
Direct Results Count Pct Average Min Max Total Damage
hit 6.7 67.38% 2610.85 2562 2855 17575
crit 3.3 32.58% 4038.44 3959 4411 13145
miss 0.0 0.04% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
deep_freeze 3202 11.2% 15.9 29.16sec 91216 77655 43134 93782 149774 95.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deep_freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.86 15.86 0.00 0.00 1.1746 0.0000 1446964
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 4.98% 43133.80 39444 63065 34106
crit 15.1 94.97% 93782.28 81052 149774 1412858
miss 0.0 0.04% 0.00 0 0 0

Action details: deep_freeze

Static Values
  • id:71757
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1567.6
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Stuns the target for $44572d. Only usable on Frozen targets. Deals ${$71757m1*$} to ${$71757M1*$} damage to targets that are permanently immune to stuns.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.058000
  • base_dd_min:1157.98
  • base_dd_max:1451.55
frostbolt 12698 44.4% 229.7 1.95sec 24980 18256 18153 37573 49569 35.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
229.72 228.97 0.00 0.00 1.3683 0.0000 5738557
Direct Results Count Pct Average Min Max Total Damage
hit 147.3 64.33% 18153.15 16543 24123 2673974
crit 81.6 35.62% 37572.93 33993 49569 3064583
miss 0.1 0.04% 0.00 0 0 0

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:2037.6
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.943000
  • base_dd_min:728.34
  • base_dd_max:928.86
frostfire_bolt 2731 9.5% 27.2 16.22sec 45433 38966 20157 44064 69459 94.6% 0.1% 0.0% 0.0% 121 361 739 71.4% 0.0% 61.4%

Stats details: frostfire_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.17 27.08 121.10 121.10 1.1660 2.2907 1234323
Direct Results Count Pct Average Min Max Total Damage
hit 1.5 5.37% 20156.89 18456 29333 29296
crit 25.6 94.58% 44064.42 37924 69459 1128684
miss 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 34.6 28.61% 360.81 205 861 12502
crit 86.4 71.39% 738.51 421 1770 63841

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • tree:fire
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • base_cost:1410.3
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$?$w3!=0[Suffering $w3 Frostfire damage per $t3 sec.][Movement slowed by $w1%.]
  • description:Launches a bolt of frostfire at the enemy, causing $s2 Frostfire damage and $?s61205[${(($m2+$M2)/2)*0.03} additional damage over $d, stacking up to 3 times][slowing the target by $s1% for $d]. This spell will be checked against the lower of the target's Frost and Fire resists.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.977000
  • base_dd_min:781.89
  • base_dd_max:997.16
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.007330
  • base_td:444.44
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
frostfire_orb 835 2.9% 8.9 51.77sec 42191 35657 0 0 0 0.0% 0.0% 0.0% 0.0% 124 0 0 0.0% 0.0% 27.4%

Stats details: frostfire_orb

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.94 8.94 123.81 0.00 1.1832 1.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 8.9 99.95% 0.00 0 0 0
miss 0.0 0.05% 0.00 0 0 0

Action details: frostfire_orb

Static Values
  • id:92283
  • school:frostfire
  • resource:mana
  • tree:frost
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a Frostfire Orb forward from the Mage's position, dealing $95969s2 Frostfire damage every second to the closest enemy target for 15 secs.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frostfire_orb_tick 835 2.9% 123.8 3.46sec 3048 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 2291 4756 30.8% 0.0% 0.0%

Stats details: frostfire_orb_tick

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
123.81 0.00 0.00 123.81 0.0000 0.0000 377382
Tick Results Count Pct Average Min Max Total Damage
hit 85.7 69.20% 2290.83 2057 2909 196258
crit 38.1 30.76% 4756.05 4228 5977 181124
miss 0.1 0.04% 0.00 0 0 0

Action details: frostfire_orb_tick

Static Values
  • id:84721
  • school:frostfire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Movement slowed by $s1%.
  • description:Inflicts Frostfire damage to an enemy and slows movement speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.134000
  • base_dd_min:228.01
  • base_dd_max:293.15
ice_lance 5087 17.8% 61.3 7.36sec 37528 32310 0 37618 59064 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.26 61.14 0.00 0.00 1.1615 0.0000 2298969
Direct Results Count Pct Average Min Max Total Damage
crit 61.1 99.96% 37618.14 32409 59064 2298969
miss 0.0 0.04% 0.00 0 0 0

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • tree:frost
  • range:35.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:940.5
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to an enemy target, damage doubled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.378000
  • base_dd_min:355.93
  • base_dd_max:453.92
ignite 1107 3.9% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 95 5287 0 0.0% 0.0% 41.9%

Stats details: ignite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 57.59 94.62 94.62 0.0000 2.0000 500253
Direct Results Count Pct Average Min Max Total Damage
hit 57.6 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 94.6 100.00% 5287.12 564 25589 500253

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1356.37
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
pet - mirror_image_3 596
mirror_fire_blast 122 20.5% 34.2 33.48sec 1273 0 1224 1837 2414 10.0% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.22 34.22 0.00 0.00 0.0000 0.0000 43564
Direct Results Count Pct Average Min Max Total Damage
hit 30.5 89.03% 1224.05 1105 1610 37294
crit 3.4 9.97% 1836.67 1657 2414 6270
miss 0.3 1.00% 0.00 0 0 0

Action details: mirror_fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.150000
  • base_dd_min:88.00
  • base_dd_max:98.00
mirror_frost_bolt 474 79.5% 85.6 12.81sec 1974 987 2110 3166 4129 9.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_frost_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
85.56 77.00 0.00 0.00 2.0000 0.0000 168923
Direct Results Count Pct Average Min Max Total Damage
hit 68.6 89.09% 2110.27 1912 2753 144770
crit 7.6 9.91% 3166.14 2867 4129 24153
miss 0.8 1.00% 0.00 0 0 0

Action details: mirror_frost_bolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.250000
  • base_dd_min:209.26
  • base_dd_max:231.29
pet - water_elemental 2430
freeze 27 1.1% 17.0 27.43sec 707 0 540 1078 1169 32.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.99 16.99 0.00 0.00 0.0000 0.0000 12010
Direct Results Count Pct Average Min Max Total Damage
hit 11.4 66.94% 539.70 529 586 6137
crit 5.4 32.06% 1078.13 1055 1169 5873
miss 0.2 1.00% 0.00 0 0 0

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.029000
  • base_dd_min:355.48
  • base_dd_max:413.13
water_bolt 2404 98.9% 205.6 2.19sec 5278 2405 4039 8118 10627 32.1% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: water_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
205.59 204.48 0.00 0.00 2.1949 0.0000 1085144
Direct Results Count Pct Average Min Max Total Damage
hit 136.8 66.91% 4038.61 3682 5327 552541
crit 65.6 32.08% 8118.08 7346 10627 532602
miss 2.1 1.01% 0.00 0 0 0

Action details: water_bolt

Static Values
  • id:31707
  • school:frost
  • resource:mana
  • tree:Unknown
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.833000
  • base_dd_min:332.17
  • base_dd_max:427.07

Resources

Resource Usage Type Res% DPR RPE
Mage_Frost_T11_372
deep_freeze mana 4.4% 58.2 1567
frostbolt mana 82.8% 12.3 2037
frostfire_orb mana 1.5% 44.9 940
ice_lance mana 10.2% 39.9 940
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29483.1 16.3 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 101738.0 101738.0 0.0%
mage_armor mana 1153.3 204658.0 177.5 0.0%
mana_gem mana 3.0 36306.9 12102.3 0.0%
master_of_elements mana 183.8 85252.0 463.8 0.0%
mp5_regen mana 1808.8 78671.0 43.5 0.0%
replenishment mana 1808.8 53498.3 29.6 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.9 0.0 187.1sec 187.1sec 6% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
brain_freeze 27.5 6.9 16.1sec 12.8sec 18% 100%

Database details

  • id:
  • cooldown name:buff_brain_freeze
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
casting 230.4 0.0 1.9sec 1.9sec 67% 67%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.0 0.0 47.4sec 47.4sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
fingers_of_frost 46.4 46.6 9.8sec 4.9sec 66% 89%

Database details

  • id:
  • cooldown name:buff_fingers_of_frost
  • tooltip:(null)
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:20.00%
icy_veins 4.5 0.0 104.5sec 104.5sec 19% 22%

Database details

  • id:12472
  • cooldown name:buff_icy_veins
  • tooltip:Casting speed of all spells increased by $s1% and reduces pushback suffered by damaging attacks while casting by $s2%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.0 0.0 52.8sec 52.8sec 29% 29%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
mage_armor 1.5 0.0 252.0sec 252.0sec 64% 64%

Database details

  • id:6117
  • cooldown name:buff_mage_armor
  • tooltip:Resistance to all magic schools increased by $s1 and regenerating $s2% of maximum mana every 5 sec. Duration of all harmful Magic effects reduced by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
molten_armor 1.6 0.0 281.5sec 281.5sec 36% 39%

Database details

  • id:30482
  • cooldown name:buff_molten_armor
  • tooltip:Causes $34913s1 Fire damage to attackers. Chance to receive a critical hit reduced by $s2%. Spell critical strike chance increased by $s3%.
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.9sec 48.9sec 25% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 112.6sec 112.6sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 66.8sec 66.8sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
mirror_image_3-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
mirror_image_3-casting 2.9 82.7 180.6sec 4.2sec 16% 16%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
water_elemental-casting 206.6 0.0 2.2sec 2.2sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dps_rotation 100.0%
water_elemental 100.0%

Procs

Count Interval
early_frost 28.2 16.2sec
mana_gem 3.0 120.7sec
munched_ignite 6.5 58.4sec
rolled_ignite 5.3 63.6sec

Statistics & Data Analysis

DPS
Population
Convergence 70.49%
σ of the average dps 5.5406
2 * σ / μ 0.0387%
95% Confidence Intervall ( μ ± 2σ ) ( 28615.33 - 28637.49 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28609.79 - 28643.03 )
Sample Data
σ 554.0610
Minimum 26354.94
Maximum 30841.59
Spread ( max - min ) 4486.65
Range ( max - min ) / 2 2243.32
Range% 7.84
10th Percentile 27949.24
90th Percentile 29363.23
( 90th Percentile - 10th Percentile ) 1413.99
Approx. Iterations needed for
1% dps error 14
0.1% dps error 1498
0.1 scale factor error with delta=300 2728
0.05 scale factor error with delta=300 10914
0.01 scale factor error with delta=300 272874
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 arcane_brilliance
3 molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
4 molten_armor,if=mana_pct>60&buff.mage_armor.up
5 water_elemental
6 snapshot_stats
7 counterspell
8 conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
9 volcanic_potion,if=!in_combat
A volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
B mana_gem,if=mana_deficit>12500
C cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
D frostfire_orb,if=target.time_to_die>=12
E mirror_image,if=target.time_to_die>=25
F berserking,if=buff.icy_veins.down&buff.bloodlust.down
G icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
H deep_freeze
I frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
J ice_lance,if=buff.fingers_of_frost.stack>1
K ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains<gcd
L mage_armor,if=(mana_pct*12)<target.time_to_die
M frostbolt
N ice_lance,moving=1
O fire_blast,moving=1

Sample Sequence

01359FJDEHBJMMMMMMJMMIMJMMMMJMKMJMMMMIMMMHMMGMIMMMMMMMKJMMMMMMMDIMMMMMMHCDGHAMMIMJMJMJMJMMMMMMLMMMMMJHMMMMMMIMMMMBIMMMKMMIDJHMJMMMMMMJMMMMJKJMMMMMHMMMJMMJFMMEIKMMJMMMMJDIMHMMMMMJIMMJMMIMGMMMMMMMJHMMMMMKMIJJMBMMMMMMMMDMMMHMKMMIMMMMMJMMMJMMMMMKMHMIMKMKJMMMMMMMMDJJMMMHMMMMIJMMMMMJMMMMMMMMMHMMFJJEJGMMMMMMJMMMMDIMMMMIMMHMJMMMMMMMMIMJMMMKMIMMHMMMMMJMMMMMMDKMKKJMMJHIJMMJIMCDGMHJMMIMMJKKKMJMMMMMJIMMMMMHMIMMMMIMMIMMMMMIMMDMMHMKMJM4JJMMMJFMM

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 637 58 20
Agility 648 68 20
Stamina 7635 6013 5950
Intellect 6070 5372 4922
Spirit 212 212 21
Health 143673 121035 0
Mana 107588 97703 0
Spell Power 9094 7569 2207
Spell Hit 16.96% 16.96% 1737
Spell Crit 28.07% 19.00% 1221
Spell Haste 21.02% 15.25% 1664
Spell Penetration 0 0 0
Mana Per 5 870 870 0
Attack Power 679 38 0
Melee Hit 14.46% 14.46% 1737
Melee Crit 18.51% 10.60% 1221
Melee Haste 12.99% 12.99% 1664
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.62% 3.68% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 7.23% 7.23% 938

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt captain_sanders_shirt,ilevel=1
chest firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
tabard empty

Talents

Arcane Rank
Arcane Concentration 0
Improved Counterspell 0
Netherwind Presence 2
Torment the Weak 0
Invocation 0
Improved Arcane Missiles 0
Improved Blink 0
Arcane Flows 0
Presence of Mind 0
Missile Barrage 0
Prismatic Cloak 0
Improved Polymorph 0
Arcane Tactics 0
Incanter's Absorption 0
Improved Arcane Explosion 0
Arcane Potency 0
Slow 0
Nether Vortex 0
Focus Magic 0
Improved Mana Gem 0
Arcane Power 0
Fire Rank
Master of Elements 2
Burning Soul 3
Improved Fire Blast 0
Ignite 3
Fire Power 0
Blazing Speed 0
Impact 0
Cauterize 0
Blast Wave 0
Hot Streak 0
Improved Scorch 0
Molten Shields 0
Combustion 0
Improved Hot Streak 0
Firestarter 0
Improved Flamestrike 0
Dragon's Breath 0
Molten Fury 0
Pyromaniac 0
Critical Mass 0
Living Bomb 0
Frost Rank
Early Frost 2
Piercing Ice 3
Shatter 2
Ice Floes 3
Improved Cone of Cold 0
Piercing Chill 2
Permafrost 1
Ice Shards 0
Icy Veins 1
Fingers of Frost 3
Improved Freeze 3
Enduring Winter 3
Cold Snap 1
Brain Freeze 3
Shattered Barrier 0
Ice Barrier 1
Reactive Barrier 0
Frostfire Orb 2
Deep Freeze 1

Profile

#!./simc

mage=Mage_Frost_T11_372
origin="http://chardev.org/?profile=87885"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/enchanting=525
talents=http://www.wowhead.com/talent#mage-0020000000000000000002303000000000000000002323021013331301021
glyphs=ice_barrier/evocation/blink/slow_fall/conjuring/arcane_brilliance/frostbolt/frostfire/deep_freeze
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/arcane_brilliance
actions+=/molten_armor,if=buff.mage_armor.down&buff.molten_armor.down
actions+=/molten_armor,if=mana_pct>60&buff.mage_armor.up
actions+=/water_elemental
actions+=/snapshot_stats
actions+=/counterspell
actions+=/conjure_mana_gem,invulnerable=1,if=mana_gem_charges<3
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|buff.icy_veins.react|target.time_to_die<=40
actions+=/mana_gem,if=mana_deficit>12500
actions+=/cold_snap,if=cooldown.deep_freeze.remains>15&cooldown.frostfire_orb.remains>30&cooldown.icy_veins.remains>30
actions+=/frostfire_orb,if=target.time_to_die>=12
actions+=/mirror_image,if=target.time_to_die>=25
actions+=/berserking,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/icy_veins,if=buff.icy_veins.down&buff.bloodlust.down
actions+=/deep_freeze
actions+=/frostfire_bolt,if=buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/ice_lance,if=buff.fingers_of_frost.stack>1
actions+=/ice_lance,if=buff.fingers_of_frost.react&pet.water_elemental.cooldown.freeze.remains actions+=/mage_armor,if=(mana_pct*12) actions+=/frostbolt
actions+=/ice_lance,moving=1
actions+=/fire_blast,moving=1
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=firelords_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,reforge=haste_crit,gems=40int_10haste,enchant=50int_25haste
shirt=captain_sanders_shirt,ilevel=1
chest=firelords_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=haste_hit,gems=40int_40int
legs=firelords_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,reforge=haste_crit,gems=20crit_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=haste_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=firelords_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=mastery_hit,gems=40int,enchant=65mastery
finger1=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,enchant=40int,suffix=129
finger2=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_hit,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=40int,enchant=lightweave_embroidery
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,reforge=haste_crit,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_crit
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4922
# gear_spirit=21
# gear_spell_power=2207
# gear_hit_rating=1737
# gear_crit_rating=1221
# gear_haste_rating=1664
# gear_mastery_rating=938
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Paladin_Retribution_T11_372 : 27406dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27406.1 15.37 / 0.06% 34.2 802.4 774.2 mana 6.04% 56.1
Origin http://chardev.org/?profile=47301
Talents http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
Glyphs
  • the_ascetic_crusader
  • hammer_of_wrath
  • templars_verdict
  • exorcism
  • seal_of_truth

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:31860|21859|21185|11476|9594|8112|8110|2690|2393&chds=0,63720&chco=C0C0C0,C0C0C0,C79C6E,C0C0C0,C79C6E,C0C0C0,C0C0C0,C79C6E,C79C6E&chm=t++31860++exorcism,C0C0C0,0,0,15|t++21859++hammer_of_wrath,C0C0C0,1,0,15|t++21185++templars_verdict,C79C6E,2,0,15|t++11476++consecration,C0C0C0,3,0,15|t++9594++crusader_strike,C79C6E,4,0,15|t++8112++holy_wrath,C0C0C0,5,0,15|t++8110++judgement_of_truth,C0C0C0,6,0,15|t++2690++melee,C79C6E,7,0,15|t++2393++melee,C79C6E,8,0,15&chtt=Paladin_Retribution_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:17,16,13,10,8,8,7,5,5,4,4,1,1,1,0&chds=0,100&chco=C79C6E,C0C0C0,C79C6E,C79C6E,C79C6E,C0C0C0,C0C0C0,C0C0C0,336600,C0C0C0,C0C0C0,C0C0C0,C79C6E,C0C0C0,C0C0C0&chl=templars_verdict|hand_of_light|crusader_strike|melee|seal_of_truth|exorcism|censure|hammer_of_wrath|darkmoon_card_hurricane|judgement_of_truth|seals_of_command|holy_wrath|melee|ancient_fury|consecration&chtt=Paladin_Retribution_T11_372+Damage+Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s7556776556544332111110zyyxxyyyyyzzyyyyxxxwwwwvvtrqoljhfdcbbbbbaaaZZYXXYYYYXXWWVVVUUUUUTTSSSRRRRRRRRQQQQQPPPQQQQQQPPPPPPPPONNOOOOOPPPQQQQRRRSSSSSRSSSSSSSSSTTUUVVVWWXXXXXXXXXWWWVVUUUTTTTTTTTTTTTTTTSSSSSSSSSSSSSSSSSSSSSSSRRRRRRRRRRRRRRRRRRRRRRRQPPPPPPQQRRRSSSSSTTTTUTTTTTTTTTTTTTTTUUUUUUVVVVVVVWWWWWWWVVVVVVVUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUTSSSSTTTTUUUUVVVVWWWWWWWWWWWWWWWWWXXXXXXXYYYYYZZZZaaaabbbbbbbbbbbbbbbbcccccccccccccddddd&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=24568&chtt=Paladin_Retribution_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y011323354567676576456544210zwwvvvvutusrrpmlkjjjjkjjiiihhhghhhhhgggffededddcccccccbcccdddddeeeeeeeeefeeeeeeddddeefggghhhijjkklmmnoopoonnnmmlkkjjiihhhhhhhhhiijjklllmmmmmmmmllkjjiihggfeedddccccbbbbbbccccccdddeeefffffffffffffffeeeeddddeeefffgghhijjkklmmnnonnnmmmllkjjjiiihihhhhhiiijjjkkklllllllkkkkkjjjjiiiiiiiiiijjjjkkkllmmnppppppooonnmmmlkkkjihffeeeeeeeeffgghhiijkkllmnnoopppppooonmmmlllkkjjjiiiiiiijjjkkklllllmmmmmmmmmmmllllllkkkkkkkkkjkjjjjjjjjjjjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=27406|max=45206&chxp=1,1,61,100&chtt=Paladin_Retribution_T11_372+DPS+Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,3,6,8,6,16,15,32,48,62,67,117,169,222,275,327,334,430,458,550,582,618,562,564,563,568,490,474,467,373,300,284,243,164,138,129,87,64,59,35,30,17,15,6,5,5,6,1,3&chds=0,618&chbh=5&chxt=x&chxl=0:|min=24652|avg=27406|max=30367&chxp=0,1,48,100&chtt=Paladin_Retribution_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Paladin_Retribution_T11_372 27406
ancient_fury 208 0.8% 3.0 210.40sec 31398 0 28575 59213 103079 9.8% 0.7% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 94194
Direct Results Count Pct Average Min Max Total Damage
hit 2.7 89.52% 28574.96 0 52503 76738
crit 0.3 9.83% 59212.87 0 103079 17456
dodge 0.0 0.66% 0.00 0 0 0

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Fury, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.061000
  • base_dd_min:207.04
  • base_dd_max:280.11
censure 2024 7.4% 394.8 1.15sec 2317 0 0 0 0 0.0% 0.7% 0.0% 0.0% 196 4232 8717 9.8% 0.0% 99.8%

Stats details: censure

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
394.81 394.81 195.78 195.78 0.0000 2.3043 914806
Direct Results Count Pct Average Min Max Total Damage
hit 392.0 99.30% 0.00 0 0 0
dodge 2.8 0.70% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 176.6 90.18% 4232.42 693 6761 747279
crit 19.2 9.82% 8716.54 1427 13928 167527

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Holy damage every $t1 sec.
  • description:Holy damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
consecration 131 0.5% 4.3 94.50sec 13825 11476 0 0 0 0.0% 0.0% 0.0% 0.0% 53 1019 1574 17.3% 0.0% 9.3%

Stats details: consecration

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.28 4.28 53.02 53.02 1.2046 0.7912 59106
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 43.8 82.67% 1018.68 750 1439 44649
crit 9.2 17.33% 1573.81 1159 2223 14457

Action details: consecration

Static Values
  • id:81297
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:81.33
  • base_dd_max:81.33
crusader_strike 3584 13.1% 111.6 4.04sec 14517 9594 11494 23674 33559 24.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
111.56 111.56 0.00 0.00 1.5131 0.0000 1619606
Direct Results Count Pct Average Min Max Total Damage
hit 83.9 75.18% 11494.04 10593 16291 964026
crit 27.7 24.82% 23674.41 21823 33559 655580

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1639.4
  • cooldown:3.72
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage.]
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.35
darkmoon_card_hurricane 1264 4.6% 93.0 5.37sec 6143 0 5562 11458 11458 9.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
93.00 93.00 0.00 0.00 0.0000 0.0000 571353
Direct Results Count Pct Average Min Max Total Damage
hit 83.8 90.14% 5561.89 5150 5562 466263
crit 9.2 9.86% 11457.54 10609 11458 105090

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
divine_plea 0 0.0% 3.2 131.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_plea

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.20 3.20 0.00 0.00 1.1997 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.2 100.00% 0.00 0 0 0

Action details: divine_plea

Static Values
  • id:54428
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • description:You gain $o1% of your total mana over $d, but the amount healed by your healing spells is reduced by $s2%.
exorcism 2288 8.3% 27.4 15.97sec 37699 31860 28903 44675 65765 17.3% 0.0% 0.0% 0.0% 79 1931 2983 17.3% 0.0% 34.8%

Stats details: exorcism

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.43 27.43 78.66 78.66 1.1833 2.0000 1033912
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 82.67% 28903.49 20656 42567 655332
crit 4.8 17.33% 44675.05 31914 65765 212318
Tick Results Count Pct Average Min Max Total Damage
hit 65.0 82.66% 1931.28 1380 2842 125575
crit 13.6 17.34% 2983.45 2132 4392 40687

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:7026.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Holy damage per $t2 sec.
  • description:Causes ${(($m1+$M1)/2)+(0.344*$cond($gt($SP,$AP),$SP,$AP))} Holy damage $?s54934[plus ${($m1+$M1)/2*0.0688} over $d ][]to an enemy target. If the target is Undead or Demon, it will always critically hit.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2590.76
  • base_dd_max:2892.33
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.066667
  • base_td:184.28
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
hammer_of_wrath 1420 5.2% 19.5 23.93sec 32991 21859 18977 39104 51898 69.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.45 19.45 0.00 0.00 1.5093 0.0000 641729
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 30.37% 18976.95 12395 25193 112116
crit 13.5 69.63% 39103.71 25533 51898 529613

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • tree:retribution
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • base_cost:-2810.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Hurls a hammer that strikes an enemy for $s1 Holy damage. Only usable on enemies that have 20% or less health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:3814.27
  • base_dd_max:4215.78
hand_of_light 4249 15.5% 176.7 2.55sec 10866 0 10866 0 39962 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.71 176.71 0.00 0.00 0.0000 0.0000 1920157
Direct Results Count Pct Average Min Max Total Damage
hit 176.7 100.00% 10865.95 4240 39962 1920157

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:10593.50
  • base_dd_max:10593.50
holy_wrath 342 1.2% 15.8 26.27sec 9767 8112 8925 13785 18970 17.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_wrath

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.85 15.85 0.00 0.00 1.2040 0.0000 154762
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 82.69% 8925.11 6531 12410 116944
crit 2.7 17.31% 13785.15 10090 18970 37818

Action details: holy_wrath

Static Values
  • id:2812
  • school:holy
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:4684.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Stunned.
  • description:Sends bolts of holy power in all directions, causing ${0.61*$SPH+$m1} Holy damage divided among all targets within $a1 yds and stunning all Demons$?s56420[, Dragonkin, Elementals,][] and Undead for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.610000
  • base_dd_min:2435.78
  • base_dd_max:2435.78
inquisition 0 0.0% 12.2 38.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.15 12.15 0.00 0.00 1.1714 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • tree:retribution
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases Holy damage done by $s1%.
  • description:Consumes all Holy Power to increase your Holy Damage by $s1%. Lasts $d per charge of Holy Power consumed.
judgement_of_truth 981 3.6% 36.2 12.59sec 12242 8110 9938 20460 33880 21.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: judgement_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.21 36.21 0.00 0.00 1.5096 0.0000 443341
Direct Results Count Pct Average Min Max Total Damage
hit 28.3 78.10% 9938.15 5617 16447 281097
crit 7.9 21.90% 20459.54 11570 33880 162244

Action details: judgement_of_truth

Static Values
  • id:31804
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1171.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${1+0.223*$SPH+0.142*$AP} Holy damage to an enemy, increased by 10% for each application of Censure on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
melee 2684 9.8% 162.4 2.79sec 7467 2690 7151 14728 21084 9.8% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
162.43 162.43 0.00 0.00 2.7760 0.0000 1212873
Direct Results Count Pct Average Min Max Total Damage
hit 107.5 66.17% 7150.83 6573 10235 768531
crit 16.0 9.83% 14727.77 13539 21084 235275
glance 39.0 24.00% 5362.97 4929 7676 209068

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth 2326 8.5% 421.2 1.07sec 2495 0 2260 4654 6715 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
421.23 421.23 0.00 0.00 0.0000 0.0000 1050983
Direct Results Count Pct Average Min Max Total Damage
hit 379.8 90.17% 2259.55 358 3260 858209
crit 41.4 9.83% 4654.38 738 6715 192774

Action details: seal_of_truth

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3279.1
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
seals_of_command 976 3.6% 422.2 1.07sec 1045 0 946 1949 2798 9.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: seals_of_command

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
422.24 422.24 0.00 0.00 0.0000 0.0000 441073
Direct Results Count Pct Average Min Max Total Damage
hit 380.6 90.15% 945.81 671 1358 360022
crit 41.6 9.85% 1948.79 1382 2798 81051

Action details: seals_of_command

Static Values
  • id:20424
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Your Seal of Righteousness, Seal of Truth, and Seal of Justice now also deal $s1% weapon damage when triggered.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.07
templars_verdict 4602 16.8% 65.1 6.86sec 31920 21185 25905 53382 76800 21.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
65.15 65.15 0.00 0.00 1.5067 0.0000 2079572
Direct Results Count Pct Average Min Max Total Damage
hit 50.9 78.11% 25905.22 23940 37281 1318291
crit 14.3 21.89% 53382.44 49317 76800 761282

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • tree:retribution
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.12
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant weapon attack that causes a percentage of weapon damage. Consumes all charges of Holy Power to increase damage dealt: 1 Holy Power: $% Weapon Damage 2 Holy Power: $% Weapon Damage 3 Holy Power: $% Weapon Damage
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.35
pet - guardian_of_ancient_kings 445
melee 445 100.0% 34.0 9.99sec 4351 2393 4629 0 4629 0.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.00 34.00 0.00 0.00 1.8182 0.0000 147935
Direct Results Count Pct Average Min Max Total Damage
hit 25.8 76.01% 4628.68 4629 4629 119615
glance 8.2 23.99% 3471.51 3472 3472 28320

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Paladin_Retribution_T11_372
consecration mana 15.2% 1.1 12882
crusader_strike mana 50.4% 8.9 1639
holy_wrath mana 20.5% 2.1 4684
inquisition holy_power 16.1% 0.0 2
judgement_of_truth mana 11.7% 10.5 1171
templars_verdict holy_power 83.9% 16651.8 2
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29259.2 16.2 0.8%
divine_plea mana 114.5 9587.1 83.7 0.0%
holy_power_crusader_strike holy_power 111.6 147.3 1.3 0.9%
initial_mana none 1.0 25122.0 25122.0 0.0%
judgements_of_the_bold mana 1340.5 194533.1 145.1 0.9%
mp5_regen mana 1808.8 105227.9 58.2 0.6%
replenishment mana 1808.8 11272.3 6.2 0.8%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 89.5 300.7sec 3.6sec 13% 100%

Database details

  • id:86700
  • cooldown name:buff_ancient_power
  • tooltip:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
avenging_wrath 4.3 0.0 121.1sec 121.1sec 19% 20%

Database details

  • id:31884
  • cooldown name:buff_avenging_wrath
  • tooltip:All damage and healing caused increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
crushing_weight 9.1 0.0 52.6sec 52.6sec 30% 30%

Database details

  • id:
  • cooldown name:buff_crushing_weight
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:10.00%
divine_plea 3.2 0.0 131.6sec 131.6sec 6% 6%

Database details

  • id:54428
  • cooldown name:buff_divine_plea
  • tooltip:Gaining $o1% of total mana. Healing spells reduced by $s2%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
divine_purpose 27.8 0.4 15.9sec 15.7sec 12% 34%

Database details

  • id:90174
  • cooldown name:buff_divine_purpose
  • tooltip:Next Holy Power ability consumes no Holy Power and casts as if 3 Holy Power were used.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:15.00%
golemblood_potion 2.0 0.0 414.2sec 414.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
inquisition 4.0 8.2 116.7sec 38.7sec 97% 98%

Database details

  • id:84963
  • cooldown name:buff_inquisition
  • tooltip:Increases Holy damage done by $s1%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_bold 18.9 17.3 24.4sec 12.6sec 74% 74%

Database details

  • id:89906
  • cooldown name:buff_judgements_of_the_bold
  • tooltip:Regaining ${$m1/10}% of your base mana per second.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.5 9.0 35.8sec 20.2sec 44% 46%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
the_art_of_war 27.7 4.7 16.1sec 13.7sec 22% 100%

Database details

  • id:
  • cooldown name:buff_the_art_of_war
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
zealotry 3.9 0.0 125.5sec 125.5sec 17% 17%

Database details

  • id:85696
  • cooldown name:buff_zealotry
  • tooltip:Crusader Strike generates 3 charges of Holy Power.
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
guardian_of_ancient_kings-bloodlust 0.2 0.0 0.0sec 0.0sec 1% 1%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
censure

Database details

  • id:31803
  • cooldown name:buff_censure
  • tooltip:Holy damage every $t1 sec.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_pure

Database details

  • id:53657
  • cooldown name:buff_judgements_of_the_pure
  • tooltip:Casting and melee speed increased by $s1%.
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 93.0 5.4sec

Statistics & Data Analysis

DPS
Population
Convergence 70.24%
σ of the average dps 7.6868
2 * σ / μ 0.0561%
95% Confidence Intervall ( μ ± 2σ ) ( 27390.73 - 27421.48 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27383.05 - 27429.17 )
Sample Data
σ 768.6842
Minimum 24652.37
Maximum 30366.61
Spread ( max - min ) 5714.24
Range ( max - min ) / 2 2857.12
Range% 10.43
10th Percentile 26464.05
90th Percentile 28428.16
( 90th Percentile - 10th Percentile ) 1964.11
Approx. Iterations needed for
1% dps error 31
0.1% dps error 3146
0.1 scale factor error with delta=300 5252
0.05 scale factor error with delta=300 21008
0.01 scale factor error with delta=300 525222
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 seal_of_truth
3 snapshot_stats
4 golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
5 auto_attack
6 judgement,if=buff.judgements_of_the_pure.down
7 guardian_of_ancient_kings
8 avenging_wrath,if=buff.zealotry.down
9 zealotry,if=buff.avenging_wrath.down
A inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
B templars_verdict,if=holy_power=3
C crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
D templars_verdict,if=buff.divine_purpose.react
E crusader_strike
F hammer_of_wrath
G exorcism,if=buff.the_art_of_war.react
H judgement,if=buff.judgements_of_the_pure.remains<2
I wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
J judgement
K holy_wrath
L consecration
M divine_plea

Sample Sequence

01245678ABEFCDEBEFEGIIIIEB9CBBEBEBEBEAGEBCDJEGKEBDEGJEGLEBIIEJKEMIIIIIEABEJIIIIIEKIIIIIEBJEIIIIIEJEBKEJEGDEAGCDGEGJ8EBFEKJEFIIIIIEBJEFLEJE9AGEBGEBJEBKEBIIEBGEGJEKEBJEGIIIIIEJEAKCDJCDDEBGEJGCDKCBBBEGJEGMEAKCDIIEJIIE8BFEJIIIIEFKCBBEFGEJIIIIIEAKEGJEGIIIGE9BGCBBCBBBCBBE7BGEJKEIIIIIEAJCDGEKJEBIIIIIELJIIEGDEBDEJIIIEKIIIIIEAMEJIIEIIIIIEBJ8EFKCDJEBFEGJEFKAEBJEGIIIIELIIIIIIEBIIIIIIIIIIIIEIIIIIIIIIIIIIIIIIIIIIIIEIIIIIIIIIIIIIIIIIIE9BIIIIIIIIIIIIIIIIIEBGIIIIIIIIIIEAIIIIIIIIIIIIIIIIIEBIIIIIIIIIIIIIIIIIIEBFIIIIIEGFEIIIHFEBIIEFIIEGJEADEFJEGKEBFCDJE8FGEBJEFKEGAFEBG4EFIIEJIIEBDEFDEGDCBBEFJEGGE9AF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 7109 5784 5345
Agility 699 117 20
Stamina 7711 6086 5930
Intellect 132 126 20
Spirit 141 141 20
Health 150923 128229 0
Mana 25122 25032 0
Spell Power 5442 3708 0
Spell Hit 17.47% 17.47% 970
Spell Crit 14.08% 9.07% 993
Spell Haste 10.90% 5.61% 719
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 16086 11974 190
Melee Hit 8.08% 8.08% 970
Melee Crit 14.64% 6.77% 993
Melee Haste 5.61% 5.61% 719
Expertise 23.15 13.15 395
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 6.42% 4.51% 83
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 19.06% 19.06% 1982

Gear

Encoded
head dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2 ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1 crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
tabard empty

Talents

Holy Rank
Arbiter of the Light 2
Protector of the Innocent 0
Judgements of the Pure 3
Clarity of Purpose 0
Last Word 0
Blazing Light 2
Denounce 0
Divine Favor 0
Infusion of Light 0
Daybreak 0
Enlightened Judgements 0
Beacon of Light 0
Speed of Light 0
Sacred Cleansing 0
Conviction 0
Aura Mastery 0
Paragon of Virtue 0
Tower of Radiance 0
Blessed Life 0
Light of Dawn 0
Protection Rank
Divinity 0
Seals of the Pure 2
Eternal Glory 0
Judgements of the Just 0
Toughness 0
Improved Hammer of Justice 0
Hallowed Ground 0
Sanctuary 0
Hammer of the Righteous 0
Wrath of the Lightbringer 0
Reckoning 0
Shield of the Righteous 0
Grand Crusader 0
Vindication 0
Holy Shield 0
Guarded by the Light 0
Divine Guardian 0
Sacred Duty 0
Shield of the Templar 0
Ardent Defender 0
Retribution Rank
Eye for an Eye 2
Crusade 3
Improved Judgement 2
Guardian's Favor 0
Rule of Law 3
Pursuit of Justice 2
Communion 1
The Art of War 3
Long Arm of the Law 2
Divine Storm 1
Sacred Shield 1
Sanctity of Battle 1
Seals of Command 1
Sanctified Wrath 3
Selfless Healer 0
Repentance 1
Divine Purpose 2
Inquiry of Faith 3
Acts of Sacrifice 0
Zealotry 1

Profile

#!./simc

paladin=Paladin_Retribution_T11_372
origin="http://chardev.org/?profile=47301"
level=85
race=human
role=hybrid
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#paladin-203002000000000000000200000000000000000023203213211113012301
glyphs=the_ascetic_crusader/hammer_of_wrath/templars_verdict/exorcism/seal_of_truth
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/seal_of_truth
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<=40
actions+=/auto_attack
actions+=/judgement,if=buff.judgements_of_the_pure.down
actions+=/guardian_of_ancient_kings
actions+=/avenging_wrath,if=buff.zealotry.down
actions+=/zealotry,if=buff.avenging_wrath.down
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<5)&(holy_power=3|buff.divine_purpose.react)
actions+=/templars_verdict,if=holy_power=3
actions+=/crusader_strike,if=buff.divine_purpose.react&(buff.divine_purpose.remains>2)&holy_power<3
actions+=/templars_verdict,if=buff.divine_purpose.react
actions+=/crusader_strike
actions+=/hammer_of_wrath
actions+=/exorcism,if=buff.the_art_of_war.react
actions+=/judgement,if=buff.judgements_of_the_pure.remains<2
actions+=/wait,sec=0.1,if=cooldown.crusader_strike.remains<0.5
actions+=/judgement
actions+=/holy_wrath
actions+=/consecration
actions+=/divine_plea
head=dragon_bone_warhelm,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_135exp_325mastery_578sta_293str,gems=reverberating_shadowspirit_40str_45sta,enchant=60str_35mastery
neck=caelestraszs_will,heroic=1,ilevel=379,quality=epic,stats=138dodge_128mastery_344sta_229str,reforge=dodge_hit,gems=40str
shoulders=reinforced_sapphirium_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=haste_mastery,gems=40str_10haste,enchant=50str_25crit
chest=reinforced_sapphirium_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=sky_strider_belt_of_the_faultline,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_429sta_266str_180haste_180mastery,reforge=haste_hit,gems=40str_67str,suffix=223
legs=reinforced_sapphirium_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_hit,gems=40str_67str,enchant=50str
hands=reinforced_sapphirium_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_hit,gems=40str_67str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,reforge=crit_exp,gems=40str
finger2=ring_of_rivalry,heroic=1,ilevel=372,quality=epic,stats=143haste_143mastery_322sta_215str,reforge=haste_hit
trinket1=crushing_weight,heroic=1,ilevel=372,quality=epic,stats=363str,equip=onattackhit_2178haste_10%_15dur_50cd
trinket2=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321str,equip=onattackhit_-5000nature_1ppm
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=crit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=relic_of_aggramar,ilevel=359,quality=epic,stats=72crit_72exp_161sta_107str,reforge=exp_mastery,gems=40str
# Gear Summary # gear_strength=5345
# gear_agility=20
# gear_stamina=5930
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=395
# gear_hit_rating=970
# gear_crit_rating=993
# gear_haste_rating=719
# gear_mastery_rating=1982
# gear_armor=21168
# gear_dodge_rating=83
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide

Priest_Disc_Smite_T11_372 : 12541dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
12541.3 173.37 / 1.38% 6.6 1902.2 1740.9 mana 27.89% 32.2
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGszRsbcRMo0hZhb0b
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:28310|27196|25725|24103|17837|12391|7767&chds=0,56621&chco=9482C9,C0C0C0,9482C9,C0C0C0,C0C0C0,C0C0C0,9482C9&chm=t++28310++devouring_plague,9482C9,0,0,15|t++27196++holy_fire,C0C0C0,1,0,15|t++25725++shadow_word_pain,9482C9,2,0,15|t++24103++power_word_shield,C0C0C0,3,0,15|t++17837++penance,C0C0C0,4,0,15|t++12391++smite,C0C0C0,5,0,15|t++7767++melee,9482C9,6,0,15&chtt=Priest_Disc_Smite_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:48,29,22,21,13,13,11,7,4,1&chds=0,100&chco=C0C0C0,C0C0C0,C0C0C0,C0C0C0,C0C0C0,9482C9,9482C9,C0C0C0,9482C9,C41F3B&chl=atonement|penance|smite|holy_fire|power_word_shield|shadow_word_pain|devouring_plague|divine_aegis|melee|darkmoon_card_volcano&chtt=Priest_Disc_Smite_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:s75566787567765544431zzxxvtttuvvwwwwuutsuwvvuuutrppqqppoopqpqrtvwxz011zzz0yzzzzyyxvuuuuttuuuuvtssrrstvx00z00z0110zzyyvuutstuuvwwvuutuwwvuttsrqpppponmmmmlllmmnnoooopppnnmmmmmlljiiihhhiiiiigffeefhiiihgeeeeddcccccaZZYYYZaabbaZYZabaaZYXWWVUUTTSRQPPPOOPQQRRSSTTSSSQQPPPPOONMMMLLLMMMLLLKKKKKLMMNMLLJJIIIHHGGGGFEEEEEEEFFFFFFFGGGFFEDDCCCCCCBBBBBBBBBBBBBCDDDEEDDCCCCCDGJKNPRTVWXYYZZZZZaaababbbbaaZZYXXWWWVWWYZbcdefghijjkkkkjiihhgffeeeddddddddddddeeeeeedddccbaaZ&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=124808&chtt=Priest_Disc_Smite_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z013120123344487542zwtroknkmmkhfgggeeheeehkmmljkllnprrpqppnpqqqonnpoolkiiiijkkkjhecbccccehhggefghhikmnpqqprrppopoonliiggggfefggeghhfghilnnllkllmnmlkjihfffgfdccdeedcbccdfhhhhgecddeffhhgggfgfghikklmnllklkkllkkigfccbabbddeegfffefgijmmmkmmlmmmlkjhggghhhgdefgfffeefghiiigfecddeeeeedddddeefhijjkkjjiijjjihgedbaZYXXYYZaaaabbbccdeeeeddddcbaZYXWVUUUVVVVWWWXXXXXXYYZZaabccdeefffghijkmnooppppoonmmllkjihgffedddccccccddefghiiijjjkkkkkjjjiiiihhgffffeeeefffggggggggh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=12541|max=22193&chxp=1,1,57,100&chtt=Priest_Disc_Smite_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,3,3,4,7,8,20,26,38,59,107,116,176,220,270,337,404,419,539,545,625,640,632,629,586,588,517,466,422,359,278,244,189,145,101,80,64,36,30,17,20,11,4,5,2,3,2,1,2&chds=0,640&chbh=5&chxt=x&chxl=0:|min=19483|avg=12541|max=23087&chxp=0,1,-193,100&chtt=Priest_Disc_Smite_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Disc_Smite_T11_372 12541
archangel 0 0.0% 14.9 30.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.89 14.89 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
atonement 6051 48.2% 477.4 0.94sec 5730 0 5035 7915 48887 24.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: atonement

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
477.43 477.43 0.00 0.00 0.0000 0.0000 2735550
Direct Results Count Pct Average Min Max Total Damage
hit 362.3 75.88% 5034.76 495 31642 1823876
crit 115.2 24.12% 7915.42 765 48887 911674

Action details: atonement

Static Values
  • id:81751
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:(null)
  • description:When you deal damage with Smite, you instantly heal a nearby low health friendly party or raid target within $81751A yards from the enemy target equal to a percentage of the damage dealt.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:32873.44
  • base_dd_max:32873.44
darkmoon_card_volcano 72 0.6% 10.2 46.41sec 3217 0 2814 4349 4543 26.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.19 10.19 0.00 0.00 0.0000 0.0000 32772
Direct Results Count Pct Average Min Max Total Damage
hit 7.5 73.74% 2813.72 2773 2940 21139
crit 2.7 26.26% 4349.29 4284 4543 11633

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1373 11.0% 19.1 24.20sec 32500 28310 0 0 0 0.0% 0.0% 0.0% 0.0% 199 2750 4281 23.9% 0.0% 95.6%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.11 19.11 199.29 199.29 1.1480 2.1690 620922
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 151.7 76.12% 2750.15 2566 3398 417206
crit 47.6 23.88% 4280.60 3965 5250 203716

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
divine_aegis 930 7.4% 115.2 3.89sec 3652 0 3652 0 26440 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
115.18 115.18 0.00 0.00 0.0000 0.0000 420641
Direct Results Count Pct Average Min Max Total Damage
hit 115.2 100.00% 3652.12 338 26440 420641

Action details: divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Critical heals have a chance to create a protective shield on the target, absorbing a percentage of the amount healed. Lasts $d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:11090.39
  • base_dd_max:11090.39
holy_fire 2693 21.5% 38.7 11.79sec 31450 27196 21579 33639 43472 24.1% 0.0% 0.0% 0.0% 372 639 995 24.1% 0.0% 59.6%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.72 38.72 372.03 372.03 1.1564 0.7240 1217696
Direct Results Count Pct Average Min Max Total Damage
hit 29.4 75.88% 21579.12 15206 28137 633960
crit 9.3 24.12% 33639.24 23493 43472 314207
Tick Results Count Pct Average Min Max Total Damage
hit 282.5 75.93% 638.65 454 828 180398
crit 89.6 24.07% 995.14 701 1279 89131

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.110000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.031200
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
penance 3591 28.6% 37.0 12.28sec 43919 17837 0 0 0 0.0% 0.0% 0.0% 0.0% 149 9607 14967 24.3% 0.0% 18.1%

Stats details: penance

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.96 36.96 149.14 148.82 2.4623 0.5486 1623386
Direct Results Count Pct Average Min Max Total Damage
none 37.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 112.7 75.72% 9606.94 6654 12142 1082602
crit 36.1 24.28% 14967.13 10281 18760 540785

Action details: penance_tick

Static Values
  • id:47666
  • school:holy
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.458000
  • base_dd_min:699.38
  • base_dd_max:790.24

Action details: penance

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • tree:discipline
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2882.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or $47750s1 healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
power_infusion 0 0.0% 4.3 121.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.28 4.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3294.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
power_word_shield 1670 13.3% 27.3 16.83sec 27615 24103 27615 0 37307 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.34 27.34 0.00 0.00 1.1457 0.0000 754859
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 100.00% 27614.59 25660 37307 754859

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • tree:discipline
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:6300.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Disc_Smite_T11_372
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $ damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.870000
  • base_dd_min:8136.94
  • base_dd_max:8136.94
shadow_fiend 0 0.0% 1.9 300.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.92 1.92 0.00 0.00 1.1781 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.9 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1581 12.6% 24.3 18.83sec 29380 25725 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3117 4861 24.1% 0.0% 96.5%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.32 24.32 202.05 202.05 1.1421 2.1593 714652
Direct Results Count Pct Average Min Max Total Damage
hit 24.3 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 153.4 75.90% 3116.61 2882 3787 477965
crit 48.7 24.10% 4861.20 4452 5851 236687

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 2733 21.8% 66.7 6.65sec 18533 12391 16293 25472 39933 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
66.68 66.68 0.00 0.00 1.4957 0.0000 1235798
Direct Results Count Pct Average Min Max Total Damage
hit 50.4 75.60% 16293.26 11612 25847 821363
crit 16.3 24.40% 25472.19 17941 39933 414435

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.$?s55692[ Damage is increased by $55692s1% if the target is afflicted by Holy Fire.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 619
melee 619 100.0% 21.4 14.24sec 10508 7767 7866 21188 26819 23.3% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.39 21.39 0.00 0.00 1.3529 0.0000 224804
Direct Results Count Pct Average Min Max Total Damage
hit 11.3 52.62% 7865.73 505 10057 88554
crit 5.0 23.34% 21187.79 1346 26819 105810
glance 5.1 24.03% 5920.26 379 7543 30441

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.7 61.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.70 5.70 0.00 0.00 1.5292 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 5.7 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Disc_Smite_T11_372
devouring_plague mana 10.1% 7.2 4537
holy_fire mana 10.9% 13.0 2425
penance mana 17.9% 10.5 4163
power_infusion mana 1.3% 0.0 2525
power_word_shield mana 19.4% 4.5 6112
shadow_word_pain mana 11.2% 7.4 3968
smite mana 29.0% 5.0 3741
Resource Gains Type Count mana Average Overflow
archangel mana 14.9 100395.4 6740.8 1.6%
blessing_of_might mana 1808.8 29305.6 16.2 0.6%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 4.6 12876.2 2808.8 0.0%
hymn_of_hope_max_mana mana 0.9 17148.5 18708.8 0.0%
initial_mana none 1.0 117810.0 117810.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1808.8 92489.2 51.1 0.6%
rapture mana 27.3 249466.1 9126.1 1.4%
replenishment mana 1808.8 60778.0 33.6 0.6%
shadow_fiend mana 21.4 88750.0 4148.4 2.8%
spirit_intellect_regen mana 1808.8 120041.0 66.4 0.6%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.9sec 181.9sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
borrowed_time 27.3 0.0 16.8sec 16.8sec 36% 33%

Database details

  • id:59888
  • cooldown name:buff_borrowed_time
  • tooltip:$s1% spell haste until next spell cast.
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:200.00%
casting 105.7 0.0 4.3sec 4.3sec 31% 31%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.4sec 46.4sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 14.9 0.0 30.7sec 30.7sec 58% 60%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 15.8 89.6 29.3sec 4.3sec 91% 86%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 0.9 3.7 0.0sec 1.5sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 51.9sec 51.9sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_infusion 4.3 0.0 121.8sec 121.8sec 14% 12%

Database details

  • id:
  • cooldown name:buff_power_infusion
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.9sec 46.9sec 26% 29%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 1.9 0.0 300.3sec 0.0sec 6% 6%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 1.9 0.1 127.1sec 115.7sec 4% 4%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 3.8 0.0 128.2sec 128.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
weakened_soul 27.3 0.0 16.8sec 16.8sec 89% 89%

Database details

  • id:6788
  • cooldown name:buff_weakened_soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 5.7 0.0 61.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 14.3%
holy_evangelism_1 8.5%
holy_evangelism_2 6.6%
holy_evangelism_3 9.1%
holy_evangelism_4 14.2%
holy_evangelism_5 47.3%

Procs

Count Interval
surge_of_light 2.0 114.7sec

Statistics & Data Analysis

DPS
Population
Convergence 3.69%
σ of the average dps 86.6831
2 * σ / μ 1.3824%
95% Confidence Intervall ( μ ± 2σ ) ( 12367.90 - 12714.63 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 98.62% - 101.38% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 12281.22 - 12801.32 )
Sample Data
σ 8668.3135
Minimum 19483.04
Maximum 23087.23
Spread ( max - min ) 3604.19
Range ( max - min ) / 2 1802.09
Range% 14.37
10th Percentile 20620.80
90th Percentile 21776.22
( 90th Percentile - 10th Percentile ) 1155.42
Approx. Iterations needed for
1% dps error 19109
0.1% dps error 1910937
0.1 scale factor error with delta=300 667908
0.05 scale factor error with delta=300 2671632
0.01 scale factor error with delta=300 66790807
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 power_infusion
A archangel,if=buff.holy_evangelism.stack>=5
B power_word_shield,if=buff.weakened_soul.down
C holy_fire
D devouring_plague,if=remains<tick_time|!ticking
E shadow_word_pain,if=remains<tick_time|!ticking
F penance
G smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BCDE5FGGGGAGGCGBFGGEGCDFBCFEAGGGBCDFGECFBCFADEGBGGCFGBCDEF6AGCGBFGEGCDF9BCFEAGGGGBCDFGECFBCAFDEGBGGCFG8BCEDFAGGGCFBEGCFDBCEFAGGGGCBDFGE9CFBCAFDEGGBGCFGECBFDAGGGCFGBEGCFDBCFAEGGGGCFBDGECFABCGGDFC89ECABDFGGCGEFC67ABCDEFGGGGCFBEDCFAGGBGGCEFGDBCFEAGCFBGGGDCF9EBCFAGGGDBCEFGCFBEDCAFGGGBGCF8E

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6994 6191 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 123660 113160 0
Spell Power 10695 8388 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 19.50% 13.27% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 3
Soul Warding 0
Renewed Hope 1
Power Infusion 1
Atonement 2
Inner Focus 1
Rapture 3
Borrowed Time 2
Reflective Shield 0
Strength of Soul 0
Divine Aegis 3
Pain Suppression 1
Train of Thought 2
Focused Will 0
Grace 2
Power Word: Barrier 1
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 3
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 0
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 2
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Disc_Smite_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033213011213200312021003000000000000000000302000200000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/power_infusion
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/power_word_shield,if=buff.weakened_soul.down
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/penance
actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Holy_Smite_AA_T11_372 : 9978dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
9978.3 4.98 / 0.05% 6.9 1437.6 1279.7 mana 45.48% 27.7
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#bcGoZfuRrRkbkMdo0o
Glyphs
  • penance
  • smite
  • shadow_word_pain
  • divine_accuracy

Charts

http://0.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:27164|23434|20914|13122|6805&chds=0,54328&chco=C0C0C0,9482C9,9482C9,C0C0C0,9482C9&chm=t++27164++holy_fire,C0C0C0,0,0,15|t++23434++devouring_plague,9482C9,1,0,15|t++20914++shadow_word_pain,9482C9,2,0,15|t++13122++smite,C0C0C0,3,0,15|t++6805++melee,9482C9,4,0,15&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x260&cht=p&chf=bg,s,333333&chd=t:38,28,15,14,5,1&chds=0,100&chco=C0C0C0,C0C0C0,9482C9,9482C9,9482C9,C41F3B&chl=smite|holy_fire|shadow_word_pain|devouring_plague|melee|darkmoon_card_volcano&chtt=Priest_Holy_Smite_AA_T11_372+Damage+Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t6677655543210yxvtrpoooomllmmnnnooooonopponnlljjjjjlmnprrtuwxz12233445654210yyxxvuuvvvwwxxyyyxwvuuuwyyyxwvutsrqppoonnnonmmmnnoonoprqqonmmlkjihihggghhhhggggghhijllkkjihfecbZYYYYYYZZZaabbbbbbcdecbaaZYYXWUUUVVVWVUUUUVVUUTUUVWWVUUTRQPNMMMMMNNONMMMMMMMMMMOPPONNMLKJIHGGFFEEEEEEEEFFFFGGHJJIHGFFEDDCCCCCCCCDDDDDCCCCDDEFFEDDCCCCCBBBBBBBBBBBBCCCBBBCCEEDDCCCDEHNSWZcehjkkkllllllmmnopoonmkjihgfeddddeeeffffeeeeffhhhgffdcbaZYXXWWWWWWWXXYYYZZZZbbbZYYXWVUTSRRSSSTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=108900&chtt=Priest_Holy_Smite_AA_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z1443567653125530xtromiefeaXUVVVXYWYbbeghilnomnpsuustrqpnkkjjjjgfgfedbabbaaaaaaZXWXVVVTTTSRRRUUXYbdehhhfeghhhhhgfdaZYZWTTSUUVVUVXZabbbbbbZYabbZYXXWWURQQSUUXXaccbbbccddddddcbZYYXWUSTTTTTSUWXacddeedccddedcbaaZXVVUTTUVXYZZZabcddddddcbbbbZZXVUTSSRSSTVWYabddcbbbcdcdccbZYXVVUSSSUUWXXXXYZaaaabaaZZZZYWVTSSRQPPQQRSTTUUUUUUUUVVVVVVUTSSRRRQQRSTTUUUVVWWXXYYZZbcdedccbaZZZabcdefghhhhihhhhhhhhffedcaZXWVTSRSSUVWXYabaaZaaabbbbaZYWWVVUTTTUUVVWXYZbbcccbbaaaaaZZZZZYWU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=9978|max=22240&chxp=1,1,45,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,2,6,6,9,11,31,33,50,64,80,107,159,206,238,268,328,430,417,461,539,501,591,534,547,567,557,515,459,404,378,313,254,219,170,145,103,74,67,44,32,26,13,16,10,7,3,2,2&chds=0,591&chbh=5&chxt=x&chxl=0:|min=9097|avg=9978|max=10891&chxp=0,1,49,100&chtt=Priest_Holy_Smite_AA_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Holy_Smite_AA_T11_372 9978
archangel 0 0.0% 15.2 30.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.20 15.20 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
chakra 0 0.0% 10.6 44.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.59 10.59 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 10.6 100.00% 0.00 0 0 0

Action details: chakra

Static Values
  • id:14751
  • school:physical
  • resource:mana
  • tree:holy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state.
  • description:When activated, your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite will put you into a Chakra state. |CFFFFFFFFSerenity (Heal, Flash Heal, Greater Heal, Binding Heal)|R Increases the critical effect chance of your direct healing spells by $81208s1%, and causes your direct heals to refresh the duration of your Renew on the target. |CFFFFFFFFSanctuary (Prayer of Healing, Prayer of Mending)|R Increases the healing done by your area of effect spells and Renew by $81206s1% and reduces the cooldown of your Circle of Healing by $/1000;81206m2 sec. |CFFFFFFFFChastise (Smite, Mind Spike)|R Increases your total damage done by Shadow and Holy spells by $81209s1%.
darkmoon_card_volcano 58 0.6% 10.2 46.52sec 2555 0 2664 4118 4287 21.0% 15.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.18 10.18 0.00 0.00 0.0000 0.0000 26010
Direct Results Count Pct Average Min Max Total Damage
hit 6.5 63.50% 2664.05 2629 2775 17224
crit 2.1 20.96% 4118.03 4062 4287 8786
miss 1.6 15.54% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 1371 13.7% 22.2 20.73sec 27928 23434 0 0 0 0.0% 15.6% 0.0% 0.0% 192 2872 4470 22.8% 0.0% 96.4%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.20 22.20 191.60 191.60 1.1917 2.2737 619921
Direct Results Count Pct Average Min Max Total Damage
hit 18.7 84.37% 0.00 0 0 0
miss 3.5 15.63% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 148.0 77.25% 2871.90 2297 3457 425080
crit 43.6 22.75% 4469.76 3549 5341 194841

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4632.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
holy_fire 2808 28.1% 38.8 11.79sec 32744 27164 22802 35509 45139 22.5% 0.0% 0.0% 0.0% 360 678 1056 22.5% 0.0% 60.9%

Stats details: holy_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.77 38.77 360.36 360.36 1.2054 0.7643 1269624
Direct Results Count Pct Average Min Max Total Damage
hit 30.1 77.52% 22801.57 13893 29216 685397
crit 8.7 22.48% 35509.31 21464 45139 309457
Tick Results Count Pct Average Min Max Total Damage
hit 279.4 77.53% 677.54 417 863 189304
crit 81.0 22.47% 1055.66 644 1334 85467

Action details: holy_fire

Static Values
  • id:14914
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2264.0
  • cooldown:10.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s2 Holy damage every $t2 seconds.
  • description:Consumes the enemy in Holy flames that cause $s1 Holy damage and an additional $o2 Holy damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.110000
  • base_dd_min:901.83
  • base_dd_max:1145.45
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.031200
  • base_td:51.04
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 2.0 300.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 1.2143 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_pain 1527 15.3% 27.8 16.41sec 24831 20914 0 0 0 0.0% 15.6% 0.0% 0.0% 192 3199 4978 22.6% 0.0% 96.2%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
27.80 27.80 191.67 191.67 1.1873 2.2696 690294
Direct Results Count Pct Average Min Max Total Damage
hit 23.5 84.45% 0.00 0 0 0
miss 4.3 15.55% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 148.3 77.36% 3198.60 2587 3862 474272
crit 43.4 22.64% 4978.27 3997 5967 216022

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4076.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
smite 3763 37.7% 83.5 5.34sec 20378 13122 18070 28186 41431 22.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: smite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
83.49 83.49 0.00 0.00 1.5529 0.0000 1701341
Direct Results Count Pct Average Min Max Total Damage
hit 64.4 77.19% 18070.30 12190 26816 1164487
crit 19.0 22.81% 28185.90 18833 41431 536854

Action details: smite

Static Values
  • id:585
  • school:holy
  • resource:mana
  • tree:holy
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3088.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Smite an enemy for $s1 Holy damage.$?s55692[ Damage is increased by $55692s1% if the target is afflicted by Holy Fire.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.856000
  • base_dd_min:652.99
  • base_dd_max:732.66
pet - shadow_fiend 562
melee 562 100.0% 22.2 14.82sec 9211 6805 7325 19812 24133 22.1% 6.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.18 22.18 0.00 0.00 1.3536 0.0000 204262
Direct Results Count Pct Average Min Max Total Damage
hit 10.7 48.10% 7324.97 505 9050 78135
crit 4.9 22.06% 19812.04 1346 24133 96928
glance 5.3 23.86% 5517.97 379 6787 29199
dodge 1.3 5.97% 0.00 0 0 0

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 62.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.99 5.99 0.00 0.00 1.5300 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 6.0 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Holy_Smite_AA_T11_372
devouring_plague mana 15.8% 6.0 4632
holy_fire mana 15.0% 13.0 2513
shadow_word_pain mana 17.4% 6.1 4076
smite mana 51.7% 5.1 4027
Resource Gains Type Count mana Average Overflow
archangel mana 15.2 92987.0 6119.2 0.4%
blessing_of_might mana 1808.8 29412.8 16.3 0.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
hymn_of_hope mana 5.0 12551.7 2510.8 0.0%
hymn_of_hope_max_mana mana 1.0 16918.7 16918.7 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
mana_potion mana 1.0 10000.0 10000.0 0.0%
mp5_regen mana 1808.8 92829.3 51.3 0.3%
replenishment mana 1808.8 55245.3 30.5 0.2%
shadow_fiend mana 20.9 83059.8 3983.5 0.0%
spirit_intellect_regen mana 1808.8 179733.9 99.4 0.2%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 13%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 122.6 0.0 3.7sec 3.7sec 38% 38%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_chastise 1.0 9.4 0.0sec 45.2sec 99% 99%

Database details

  • id:81209
  • cooldown name:buff_chakra_chastise
  • tooltip:Increases the damage done by your Shadow and Holy spells by $s1%.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
chakra_pre 10.6 0.0 44.8sec 44.8sec 19% 23%

Database details

  • id:14751
  • cooldown name:buff_chakra_pre
  • tooltip:Your next Heal, Flash Heal, Greater Heal, Binding Heal, Prayer of Healing, Prayer of Mending, Mind Spike or Smite spell will put you into a Chakra state.
  • max_stacks:1
  • duration:-0.00
  • cooldown:30.00
  • default_chance:100.00%
darkmoon_card_volcano 10.2 0.0 46.5sec 46.5sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
holy_archangel 15.2 0.0 30.3sec 30.3sec 59% 59%

Database details

  • id:81700
  • cooldown name:buff_holy_archangel
  • tooltip:Healing increased by $w2%.
  • max_stacks:1
  • duration:18.00
  • cooldown:30.00
  • default_chance:100.00%
holy_evangelism 16.1 106.1 28.8sec 3.7sec 94% 84%

Database details

  • id:81661
  • cooldown name:buff_holy_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
hymn_of_hope 1.0 4.0 0.0sec 1.6sec 3% 3%

Database details

  • id:64904
  • cooldown name:buff_hymn_of_hope
  • tooltip:Maximum mana increased by $s2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.2 0.0 52.0sec 52.0sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 10.0 0.0 47.3sec 47.3sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadowfiend 2.0 0.0 300.3sec 0.0sec 7% 7%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
surge_of_light 2.3 0.2 120.0sec 107.1sec 5% 5%

Database details

  • id:88688
  • cooldown name:buff_surge_of_light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:3.00%
theralions_mirror 4.0 0.0 125.4sec 125.4sec 17% 17%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
shadow_fiend-bloodlust 0.1 0.0 0.0sec 0.0sec 0% 3%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 6.0 0.0 62.5sec 0.0sec 7% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 100.0%
holy_evangelism_0 16.7%
holy_evangelism_1 10.1%
holy_evangelism_2 10.6%
holy_evangelism_3 11.2%
holy_evangelism_4 11.3%
holy_evangelism_5 40.1%

Procs

Count Interval
surge_of_light 2.5 106.6sec

Statistics & Data Analysis

DPS
Population
Convergence 71.43%
σ of the average dps 2.4877
2 * σ / μ 0.0499%
95% Confidence Intervall ( μ ± 2σ ) ( 9973.31 - 9983.26 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 9970.82 - 9985.74 )
Sample Data
σ 248.7737
Minimum 9096.68
Maximum 10890.57
Spread ( max - min ) 1793.90
Range ( max - min ) / 2 896.95
Range% 8.99
10th Percentile 9669.89
90th Percentile 10306.87
( 90th Percentile - 10th Percentile ) 636.98
Approx. Iterations needed for
1% dps error 24
0.1% dps error 2486
0.1 scale factor error with delta=300 550
0.05 scale factor error with delta=300 2200
0.01 scale factor error with delta=300 55011
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 snapshot_stats
5 mana_potion,if=mana_pct<=75
6 shadow_fiend,if=mana_pct<=50
7 hymn_of_hope,if=pet.shadow_fiend.active&time>200
8 berserking
9 chakra
A archangel,if=buff.holy_evangelism.stack>=5
B holy_fire
C devouring_plague,if=remains<tick_time|!ticking
D shadow_word_pain,if=remains<tick_time|!ticking
E smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains<cooldown.archangel.remains+0.5

Sample Sequence

01389BC5CDEEEEAEEEBEEEEEDBCBDAEE9EEBE6CEBDBAEECEDEE9BBDCCAEEBEEEEDBDCBAEEEDE9EBCBDAEEBEEECEDB98BAEDECEBEEBDCBAEEEE9EEDBCBDAEEEBEEEC9BDDBAEEEEDDBCBDAEEBE9CBDCBACEE67BD8DECEBAEEEEDE9EBCCBDAEEEBEECEDB9BAEEDCDEEBBDCAEEBEE9EEDDBCBAEDEEEB9CBDAEEBEEDB8C

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 1.40% 1.40% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 25.10% 19.14% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 20124 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 3
Evangelism 2
Archangel 1
Inner Sanctum 0
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 2
Empowered Healing 3
Divine Fury 3
Desperate Prayer 1
Surge of Light 1
Inspiration 2
Divine Touch 2
Holy Concentration 2
Lightwell 1
Tome of Light 2
Rapid Renewal 1
Spirit of Redemption 1
Serendipity 2
Body and Soul 0
Chakra 1
Revelations 1
Blessed Resilience 0
Test of Faith 2
State of Mind 2
Circle of Healing 1
Guardian Spirit 1
Shadow Rank
Darkness 0
Improved Shadow Word: Pain 0
Veiled Shadows 1
Improved Psychic Scream 0
Improved Mind Blast 0
Improved Devouring Plague 0
Twisted Faith 0
Shadowform 0
Phantasm 0
Harnessed Shadows 0
Silence 0
Vampiric Embrace 0
Masochism 0
Mind Melt 0
Pain and Suffering 0
Vampiric Touch 0
Paralysis 0
Psychic Horror 0
Sin and Punishment 0
Shadowy Apparition 0
Dispersion 0

Profile

#!./simc

priest=Priest_Holy_Smite_AA_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-033210000000000000000233112221211201102211001000000000000000000
glyphs=penance/smite/shadow_word_pain/divine_accuracy
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/snapshot_stats
actions+=/mana_potion,if=mana_pct<=75
actions+=/shadow_fiend,if=mana_pct<=50
actions+=/hymn_of_hope,if=pet.shadow_fiend.active&time>200
actions+=/berserking
actions+=/chakra
actions+=/archangel,if=buff.holy_evangelism.stack>=5
actions+=/holy_fire
actions+=/devouring_plague,if=remains actions+=/shadow_word_pain,if=remains actions+=/smite,if=buff.holy_evangelism.stack<5|buff.holy_evangelism.remains head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Priest_Shadow_T11_372 : 26998dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26997.7 9.73 / 0.04% 17.8 1516.4 1531.8 mana 0.00% 37.4
Origin http://chardev.org/?profile=18129
Talents http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
Glyphs
  • spirit_tap
  • inner_fire
  • psychic_scream
  • fading
  • fortitude
  • levitate
  • shadow_word_pain
  • shadow_word_death
  • mind_flay

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:81431|64999|35385|30072|25619|23203|21532|11572|7239&chds=0,162862&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++81431++devouring_plague,9482C9,0,0,15|t++64999++vampiric_touch,9482C9,1,0,15|t++35385++mind_blast_3,9482C9,2,0,15|t++30072++mind_blast_2,9482C9,3,0,15|t++25619++mind_blast_1,9482C9,4,0,15|t++23203++shadow_word_death,9482C9,5,0,15|t++21532++mind_blast_0,9482C9,6,0,15|t++11572++mind_flay,9482C9,7,0,15|t++7239++melee,9482C9,8,0,15&chtt=Priest_Shadow_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x330&cht=p&chf=bg,s,333333&chd=t:29,20,11,10,6,5,4,4,4,3,3,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C41F3B&chl=mind_flay|vampiric_touch|shadow_word_pain|devouring_plague|mind_blast_3|melee|mind_blast_2|shadow_word_death|shadowy_apparition|mind_blast_1|devouring_plague_burst|mind_blast_0|darkmoon_card_volcano&chtt=Priest_Shadow_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fpooppqrx777731ywussrqqpooonnnmklkkkkjiiiiiihhgfeddddddcccbbbaaaaZZZZZYXXXWWWWWWWWWWXXXXXXXXYXXXXXYacfijkmmnnnnnnnmmllkkjjjjiiiiihhgggfffffeedccbbbaaaaZZZZZZYYYYXXXWWWWWVVVVVVVVVVVVWWWWVVVUUWYbdfghijjjjjiiiiiiihhggfffeeeedddddcccbbbaaZZYYYYYXXXWWWWWWWWVVVVVUTTTTTTTTTTTTTTTTTTTTTTTTTUWYbceffgggggggggggfffeeeeeeeedddddddddddddcccbbbbccccccccccccccccccbbbbbbbbbbbbbbccccccddddegikmnooooonnnnnnnnnmmmlllllllmmmmmmmmmmnnnooooooooopppppppppppppppppoooooooo&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=150754&chtt=Priest_Shadow_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:uxx222121114578655421zxxtsrsqrppnmllmlkjiijjijijhihhhhiiihhiiiihhhhgggggggggffeeeeefggggghhhiijjjkklllmmmlllllllllkjjiihhhggffffffffffffffgghhhhiiiiiiiiiiiiijiiihhggggggggggggghhiiijkkllmmmnnnnnnnnnnmmmmlkkjiiihhhhggggffeeeeffffggggggghhhhiiiiiiiiiiihhhhhhhhhhggggggggghhhiiiiiijjkkkkllllllllllllkkkjjiihhhggggggggffggggghhiiijjjjjjjkkkkkkkkkjjjjiiiiiiiiiiiijjjjkklmmnnooppqqrrrrrrrrrqqqppoonnmmlllkkjjjiiiiiiiijjjjkkkllmmmmmmnnnnnmmmmmllllkkkjjjjjjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26998|max=44459&chxp=1,1,61,100&chtt=Priest_Shadow_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:3,2,2,6,6,6,18,29,39,60,110,108,165,221,272,327,411,448,569,599,615,643,605,630,593,565,501,440,385,358,294,232,182,137,106,96,58,61,28,19,18,9,8,6,3,4,0,2,0,1&chds=0,643&chbh=5&chxt=x&chxl=0:|min=25261|avg=26998|max=29113&chxp=0,1,45,100&chtt=Priest_Shadow_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Priest_Shadow_T11_372 26998
archangel 0 0.0% 5.3 92.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: archangel

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.30 5.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: archangel

Static Values
  • id:87151
  • school:holy
  • resource:mana
  • tree:discipline
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Consumes your Evangelism effects, causing an effect depending on what type of Evangelism effect is consumed: |CFFFFFFFFArchangel (Evangelism)|R Instantly restores $87152s1% of your total mana and increases your healing done by $81700s1% for each stack. Lasts for $81700d. $87151s2 sec cooldown. |CFFFFFFFFDark Archangel (Dark Evangelism)|R Instantly restores $87153s3% of your total mana and increases the damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death by $87153s1% for each stack. Lasts for $87153d. $87151s3 sec cooldown.
darkmoon_card_volcano 79 0.3% 10.2 46.27sec 3495 0 3084 4768 5191 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.23 10.23 0.00 0.00 0.0000 0.0000 35759
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 75.63% 3084.29 3023 3360 23870
crit 2.5 24.37% 4767.60 4671 5191 11889

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
devouring_plague 4227 15.7% 20.2 22.86sec 94453 81431 0 0 0 0.0% 0.0% 0.0% 0.0% 203 4702 9899 22.3% 0.0% 99.0%

Stats details: devouring_plague

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 203.38 203.38 1.1599 2.2009 1191614
Direct Results Count Pct Average Min Max Total Damage
hit 20.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.1 77.73% 4701.84 3487 7010 743282
crit 45.3 22.27% 9898.63 7288 14652 448332

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4786.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Causes $w1 damage every $t1 seconds, healing the caster.
  • description:Afflicts the target with a disease that causes $o1 Shadow damage over $d. 15% of damage caused by the Devouring Plague heals the caster. This spell can only affect one target at a time.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.185000
  • base_td:155.01
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
devouring_plague_burst 795 2.9% 20.2 22.86sec 17774 0 14232 29971 43970 22.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.23 20.23 0.00 0.00 0.0000 0.0000 359564
Direct Results Count Pct Average Min Max Total Damage
hit 15.7 77.50% 14232.29 10466 21038 223121
crit 4.6 22.50% 29971.10 21873 43970 136443

Action details: devouring_plague_burst

Static Values
  • id:0
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6183.39
  • base_dd_max:6183.39
mind_blast_0 316 1.2% 5.7 72.75sec 25134 21532 20047 42348 61329 22.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_0

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.67 5.67 0.00 0.00 1.1673 0.0000 142627
Direct Results Count Pct Average Min Max Total Damage
hit 4.4 77.19% 20046.78 17287 29344 87807
crit 1.3 22.81% 42348.31 36130 61329 54820

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_1 876 3.2% 13.1 33.09sec 30183 25619 24118 50872 84494 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_1

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.11 13.11 0.00 0.00 1.1781 0.0000 395810
Direct Results Count Pct Average Min Max Total Damage
hit 10.1 77.33% 24117.65 20772 40428 244577
crit 3.0 22.67% 50872.05 43413 84494 151232

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_2 1082 4.0% 13.8 30.33sec 35514 30072 28467 59899 107659 22.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_2

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.77 13.77 0.00 0.00 1.1810 0.0000 489006
Direct Results Count Pct Average Min Max Total Damage
hit 10.7 77.58% 28467.03 24256 51512 304085
crit 3.1 22.42% 59899.26 50695 107659 184921

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_blast_3 1550 5.7% 16.9 25.38sec 41561 35385 33222 70121 130824 22.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast_3

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.86 16.86 0.00 0.00 1.1746 0.0000 700855
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 77.40% 33222.28 27740 62595 433617
crit 3.8 22.60% 70121.03 57977 130824 267238

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3500.0
  • cooldown:6.50
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.985800
  • base_dd_min:1277.68
  • base_dd_max:1349.94
mind_flay 7804 28.9% 123.0 3.64sec 28688 11572 0 0 0 0.0% 0.0% 0.0% 0.0% 368 7343 15475 27.6% 0.0% 60.7%

Stats details: mind_flay

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
122.97 122.97 367.96 367.96 2.4790 0.7453 3527777
Direct Results Count Pct Average Min Max Total Damage
hit 123.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 266.4 72.40% 7343.36 6348 11446 1956360
crit 101.5 27.60% 15474.89 13267 23922 1571417

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1647.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:Movement speed slowed.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d and slowing their movement speed by $s2%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.257000
  • base_td:167.30
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_fiend 0 0.0% 5.3 92.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_fiend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.26 5.26 0.00 0.00 1.1375 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.3 100.00% 0.00 0 0 0

Action details: shadow_fiend

Static Values
  • id:34433
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Damage taken by area of effect attacks is reduced. Lasts $d.
shadow_word_death 1060 3.9% 17.6 6.31sec 27237 23203 21771 45878 67271 22.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.59 17.59 0.00 0.00 1.1739 0.0000 479092
Direct Results Count Pct Average Min Max Total Damage
hit 13.6 77.33% 21771.34 18828 32187 296116
crit 4.0 22.67% 45878.19 39351 67271 182976

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2297.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s1 Shadow damage to the target. Deals three times as much damage to targets below 25% health. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.282000
  • base_dd_min:301.52
  • base_dd_max:301.52
shadow_word_pain 4067 15.1% 1.0 395.59sec 1833861 1767888 0 0 0 0.0% 0.0% 0.0% 0.0% 202 5500 11588 22.6% 0.0% 99.8%

Stats details: shadow_word_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 202.09 202.09 1.0373 2.2325 1389179
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 156.5 77.44% 5500.34 4126 7825 860772
crit 45.6 22.56% 11587.77 8623 16354 528407

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowy_apparition 993 3.7% 28.8 15.49sec 15596 0 12299 25884 33306 28.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.80 27.75 0.00 0.00 0.0000 0.0000 449084
Direct Results Count Pct Average Min Max Total Damage
hit 19.8 71.41% 12299.30 11165 15936 243714
crit 7.9 28.59% 25884.42 23334 33306 205370

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.06
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:When you deal periodic damage with your Shadow Word: Pain, you have a chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal shadow damage. While moving, the chance to summon the shadowy apparation is increased.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.515000
  • base_dd_min:516.19
  • base_dd_max:516.19

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4211.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.183000
  • base_td:221.17
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch 5467 20.3% 32.4 14.09sec 76314 64999 0 0 0 0.0% 0.0% 0.0% 0.0% 200 9891 20818 22.5% 0.0% 98.3%

Stats details: vampiric_touch

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.39 32.39 200.15 200.15 1.1741 2.2194 2471475
Direct Results Count Pct Average Min Max Total Damage
hit 32.4 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 155.1 77.51% 9890.89 7180 14590 1534516
crit 45.0 22.49% 20818.13 15006 30493 936959

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • tree:shadow
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3294.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:Causes $o2 Shadow damage over $d to your target and causes up to 10 party or raid members to gain 1% of their maximum mana per 10 sec when you deal damage from Mind Blast.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.400000
  • base_td:108.70
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - shadow_fiend 1397
melee 1397 100.0% 58.3 7.08sec 9826 7239 7471 20216 26511 21.9% 0.0% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.26 58.26 0.00 0.00 1.3574 0.0000 572426
Direct Results Count Pct Average Min Max Total Damage
hit 31.5 54.11% 7470.51 505 9942 235507
crit 12.8 21.94% 20215.71 1346 26511 258407
glance 14.0 23.95% 5627.92 379 7456 78512

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.544000
  • base_dd_min:221.00
  • base_dd_max:271.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 15.6 27.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.61 15.61 0.00 0.00 1.5325 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 15.6 100.00% 0.00 0 0 0

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:focus
  • tree:Unknown
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by the Shadowfiend by $s2% for $d.

Resources

Resource Usage Type Res% DPR RPE
Priest_Shadow_T11_372
devouring_plague mana 14.1% 19.7 4786
mind_blast_0 mana 2.9% 7.2 3500
mind_blast_1 mana 6.7% 8.6 3500
mind_blast_2 mana 7.0% 10.1 3500
mind_blast_3 mana 8.6% 11.9 3500
mind_flay mana 29.5% 17.4 1647
shadow_word_death mana 5.9% 11.9 2297
shadow_word_pain mana 0.6% 435.5 4211
vampiric_touch mana 15.6% 23.2 3294
Resource Gains Type Count mana Average Overflow
archangel mana 5.3 178445.8 33662.0 4.0%
blessing_of_might mana 1808.8 28212.1 15.6 4.3%
dispersion mana 0.0 337.2 7560.8 0.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 105090.0 105090.0 0.0%
masochism mana 17.6 149170.3 8480.6 13.0%
mp5_regen mana 1808.8 89075.9 49.2 4.3%
replenishment mana 1808.8 52775.9 29.2 4.3%
shadow_fiend mana 58.3 188589.5 3237.2 14.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.4sec 181.4sec 7% 9%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 82.0 0.0 5.5sec 5.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_archangel 5.3 0.0 92.5sec 92.5sec 21% 23%

Database details

  • id:87153
  • cooldown name:buff_dark_archangel
  • tooltip:Damage done by your Mind Flay, Mind Spike, Mind Blast and Shadow Word: Death increased by $w1%.
  • max_stacks:1
  • duration:18.00
  • cooldown:90.00
  • default_chance:100.00%
dark_evangelism 6.3 484.6 75.9sec 0.9sec 98% 96%

Database details

  • id:81661
  • cooldown name:buff_dark_evangelism
  • tooltip:Increases the damage done by your Smite, Holy Fire and Penance spells by $s1% and reduces the mana cost of those spells by $s2%.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
darkmoon_card_volcano 10.2 0.0 46.3sec 46.3sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
empowered_shadow 1.0 48.4 388.7sec 9.2sec 99% 98%

Database details

  • id:95799
  • cooldown name:buff_empowered_shadow
  • tooltip:$w1% increased periodic shadow damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
glyph_of_shadow_word_death 8.8 0.0 13.2sec 13.2sec 11% 11%

Database details

  • id:
  • cooldown name:buff_glyph_of_shadow_word_death
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
lightweave_embroidery 9.3 0.0 51.5sec 51.5sec 30% 30%

Database details

  • id:
  • cooldown name:buff_lightweave_embroidery
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:25.00%
power_torrent_mh 10.0 0.0 47.0sec 47.0sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
self_movement 8.9 0.0 13.1sec 13.1sec 5% 5%

Database details

  • id:
  • cooldown name:buff_self_movement
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_orb 44.3 58.4 10.2sec 4.3sec 58% 89%

Database details

  • id:77487
  • cooldown name:buff_shadow_orb
  • tooltip:Consumed to increase damage done by Mind Blast or Mind Spike.
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend 5.3 0.0 92.2sec 0.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_shadowfiend
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
theralions_mirror 4.2 0.0 117.3sec 117.3sec 18% 18%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 2.0 0.0 414.4sec 414.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
shadow_fiend-bloodlust 0.2 0.0 0.0sec 0.0sec 0% 2%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_fiend-shadowcrawl 15.6 0.0 27.6sec 0.0sec 16% 82%

Database details

  • id:
  • cooldown name:buff_shadowcrawl
  • tooltip:(null)
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
inner_fire

Database details

  • id:588
  • cooldown name:buff_inner_fire
  • tooltip:Increases armor from items by $s1% and spell power by $s2.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_form

Database details

  • id:
  • cooldown name:buff_shadow_form
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vampiric_embrace

Database details

  • id:
  • cooldown name:buff_vampiric_embrace
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
dark_evangelism_0 4.4%
dark_evangelism_1 0.1%
dark_evangelism_2 0.8%
dark_evangelism_3 0.7%
dark_evangelism_4 2.5%
dark_evangelism_5 91.5%
holy_evangelism_0 100.0%
mind_spike_0 100.0%
shadow_orb_0 11.5%
shadow_orb_1 26.5%
shadow_orb_2 27.9%
shadow_orb_3 34.1%

Procs

Count Interval
shadowy_apparation_proc 28.8 15.5sec

Statistics & Data Analysis

DPS
Population
Convergence 71.17%
σ of the average dps 4.8635
2 * σ / μ 0.0360%
95% Confidence Intervall ( μ ± 2σ ) ( 26988.02 - 27007.47 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26983.15 - 27012.33 )
Sample Data
σ 486.3467
Minimum 25261.39
Maximum 29113.08
Spread ( max - min ) 3851.69
Range ( max - min ) / 2 1925.84
Range% 7.13
10th Percentile 26404.92
90th Percentile 27640.61
( 90th Percentile - 10th Percentile ) 1235.69
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1298
0.1 scale factor error with delta=300 2102
0.05 scale factor error with delta=300 8410
0.01 scale factor error with delta=300 210251
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fortitude
3 inner_fire
4 shadow_form
5 vampiric_embrace
6 snapshot_stats
7 volcanic_potion,if=!in_combat
8 volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
9 mind_blast,if=buff.shadow_orb.stack>=1
A berserking
B shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains<gcd+0.5)&miss_react
C devouring_plague,if=(!ticking|dot.devouring_plague.remains<gcd+1.0)&miss_react
D stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains<cast_time+2.5
E vampiric_touch,if=(!ticking|dot.vampiric_touch.remains<cast_time+2.5)&miss_react
F start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
G archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
H shadow_word_death,health_percentage<=25
I shadow_fiend
J mind_blast
K mind_flay
L dispersion,moving=1
M devouring_plague,moving=1,if=mana_pct>10
N shadow_word_death,moving=1
O dispersion

Sample Sequence

013457ABCEIJKKGKK9KEKK9KCKK9EKKKJKKEK9CKKKEJKKK9KCEIK9KKK9EKKC9KKEGK9KKK9ECKK9KKEK9KKK9CEKK9KKE9IKKC9KEKK9KAKK9EKCKGK9KKEK9KKCK9EKKK9KEKK9CKKE9KKK9KECKIJKKK9EKKK9CKEGK9KKK9EKCK9KKEK9KKK9CEKK9KKEK9KKCI9EKKAK9KKEK9CKGKK9EKKK9KECKJKKFHHD9EKKK9CFHHDEKJKKFHHD9EKKCFHHDJKEKKFHHD9KIECGK9FHHDKK9EKFHHDK9CKEFHHDJKK8K9EFHHDKC9KKEFHHD9KKK9ECFHHDK

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 647 67 20
Agility 656 76 20
Stamina 7604 5984 5913
Intellect 6082 5383 4941
Spirit 1798 1798 1599
Health 149425 126801 0
Mana 110940 101055 0
Spell Power 9692 7580 2207
Spell Hit 17.00% 17.00% 143
Spell Crit 18.10% 12.02% 446
Spell Haste 28.85% 22.71% 2451
Spell Penetration 0 0 0
Mana Per 5 1029 1029 0
Attack Power 690 47 0
Melee Hit 1.19% 1.19% 143
Melee Crit 13.89% 6.04% 446
Melee Haste 19.14% 19.14% 2451
Expertise 0.00 0.00 0
Armor 23897 8502 8502
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.34% 3.43% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1058

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
shirt empty
chest mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2 planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
tabard empty

Talents

Discipline Rank
Improved Power Word: Shield 0
Twin Disciplines 3
Mental Agility 2
Evangelism 2
Archangel 1
Inner Sanctum 2
Soul Warding 0
Renewed Hope 0
Power Infusion 0
Atonement 0
Inner Focus 0
Rapture 0
Borrowed Time 0
Reflective Shield 0
Strength of Soul 0
Divine Aegis 0
Pain Suppression 0
Train of Thought 0
Focused Will 0
Grace 0
Power Word: Barrier 0
Holy Rank
Improved Renew 0
Empowered Healing 0
Divine Fury 0
Desperate Prayer 0
Surge of Light 0
Inspiration 0
Divine Touch 0
Holy Concentration 0
Lightwell 0
Tome of Light 0
Rapid Renewal 0
Spirit of Redemption 0
Serendipity 0
Body and Soul 0
Chakra 0
Revelations 0
Blessed Resilience 0
Test of Faith 0
State of Mind 0
Circle of Healing 0
Guardian Spirit 0
Shadow Rank
Darkness 3
Improved Shadow Word: Pain 2
Veiled Shadows 2
Improved Psychic Scream 0
Improved Mind Blast 3
Improved Devouring Plague 2
Twisted Faith 2
Shadowform 1
Phantasm 0
Harnessed Shadows 2
Silence 0
Vampiric Embrace 1
Masochism 2
Mind Melt 2
Pain and Suffering 2
Vampiric Touch 1
Paralysis 0
Psychic Horror 0
Sin and Punishment 2
Shadowy Apparition 3
Dispersion 1

Profile

#!./simc

priest=Priest_Shadow_T11_372
origin="http://chardev.org/?profile=18129"
level=85
race=troll
role=spell
use_pre_potion=1
professions=tailoring=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#priest-032212000000000000000000000000000000000000322032210201222100231
glyphs=spirit_tap/inner_fire/psychic_scream/fading/fortitude/levitate/shadow_word_pain/shadow_word_death/mind_flay
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fortitude
actions+=/inner_fire
actions+=/shadow_form
actions+=/vampiric_embrace
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat
actions+=/volcanic_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mind_blast,if=buff.shadow_orb.stack>=1
actions+=/berserking
actions+=/shadow_word_pain,if=(!ticking|dot.shadow_word_pain.remains actions+=/devouring_plague,if=(!ticking|dot.devouring_plague.remains actions+=/stop_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains>=0.2|dot.vampiric_touch.remains actions+=/vampiric_touch,if=(!ticking|dot.vampiric_touch.remains actions+=/start_moving,health_percentage<=25,if=cooldown.shadow_word_death.remains<=0.1
actions+=/archangel,if=buff.dark_evangelism.stack>=5&dot.vampiric_touch.remains>5&dot.devouring_plague.remains>5
actions+=/shadow_word_death,health_percentage<=25
actions+=/shadow_fiend
actions+=/mind_blast
actions+=/mind_flay
actions+=/dispersion,moving=1
actions+=/devouring_plague,moving=1,if=mana_pct>10
actions+=/shadow_word_death,moving=1
actions+=/dispersion
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_spi,gems=burning_shadowspirit_20int_20spi_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
shoulders=mercurial_shoulderwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_266int_171spi_429sta,gems=67int_10haste,enchant=50int_25haste
chest=mercurial_vestment,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_spi,gems=67int_20int_20spi_20int,enchant=20all
waist=soul_breath_belt_of_the_undertow,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_429sta_266int_180haste_180spi,gems=20haste_20int_67int_10int,suffix=231
legs=mercurial_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_345int_217spi_578sta,gems=20haste_20int_40int_20int,enchant=95int_55spi
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_spi,gems=40int_10haste,enchant=35mastery
wrists=bracers_of_the_dark_mother,heroic=1,type=cloth,ilevel=379,quality=epic,stats=612armor_209int_153mastery_133spi_344sta,reforge=mastery_haste,gems=20haste_20int_10int,enchant=50int
hands=mercurial_gloves,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_spi,gems=40int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_spi
finger2=planetary_band_of_the_undertow,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143spi,suffix=131
trinket1=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_spi,gems=20haste_20int_10int,enchant=lightweave_embroidery
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_spi,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=finkles_mixer_upper,heroic=1,ilevel=372,quality=epic,stats=121int_81mastery_81spi_181sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5913
# gear_intellect=4941
# gear_spirit=1599
# gear_spell_power=2207
# gear_hit_rating=143
# gear_crit_rating=446
# gear_haste_rating=2451
# gear_mastery_rating=1058
# gear_armor=8502
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# back=shroud_of_endless_grief,heroic=1,enchant=lightweave_embroidery
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Rogue_Assassination_T11_372 : 27277dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27277.3 11.96 / 0.04% 1022.6 26.7 26.5 energy 42.07% 36.3
Origin http://chardev.org/?profile=36311
Talents http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
Glyphs
  • expose_armor
  • mutilate
  • backstab
  • rupture

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:27505|18337|16508|14307|10462|3223|1609&chds=0,55010&chco=336600,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E&chm=t++27505++envenom,336600,0,0,15|t++18337++garrote,C55D54,1,0,15|t++16508++mutilate,C79C6E,2,0,15|t++14307++backstab,C79C6E,3,0,15|t++10462++rupture,C55D54,4,0,15|t++3223++melee_main_hand,C79C6E,5,0,15|t++1609++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Assassination_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:24,14,12,10,10,9,7,6,4,2,1&chds=0,100&chco=336600,336600,C79C6E,336600,336600,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54&chl=instant_poison|envenom|melee_main_hand|deadly_poison|venomous_wound|backstab|mutilate_mh|melee_off_hand|mutilate_oh|rupture|garrote&chtt=Rogue_Assassination_T11_372+Damage+Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:m2671uwvstvrtrtsnklkjgedcbbbbbXWXXYYZaabbbbbbbbbbbbaZYXWVVVVUUUUUUUUUUUUUUUUUUUUUUUUVVVVVVVVVVVVVVUUVUUUUUUUUUUUUUUUUUUUUUVXWUVVVVWXXXXXXWWWVVVVUVUUUUUUUUUUUUUUUUUVVUVVVVVVVVVVVUUUUVVVVVVVWWVVVVVUUUUUUUUUUUUUUUTTTTTTTTUUVVWWXXXYYYZZZYYYYYYXXXYabZYXXXYYYZZZZZZZZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYZZZZZZZZZZZaZaaaaaaaaabbbbbcccccddddddddddddddddddddddddeeeeeeeeeeeeeeffillkjiiiiihhhhiiiiiiiiihhhhhgfeddddefghjklmnopqqrrrrqqonnmlkjjihhggggfffffffffeeeeeeeeeee&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=102&chtt=Rogue_Assassination_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:z0221233443467777421zxwuutrqponnnmmllkkkjjjiiiihggfffeeddccccbbbbaaaaaaaabbbbbbbbbccccccccccccccccbbbbbbbbbaaaaaaaabbcccdddeefffggghhhihhhhhhhhggffffeeeedddddcccccccccccccccccccdddddddcccccccccccbbbbbaaaaaaaaaabbbbcccdddeeeffffggggffffgggggghhhhhiiijjjjkkkkkkkjjjjiihhhggfffeeeddddccccccccccccccccccccccccddddddddeeeeeeeefffffffffffffffffffeeeeeeeeeeeffffgghiijjkkkllmmnnooopppoooooonnnmmmmlllllllllllllllmmmmmmmmmlllkkkjjiiihhhhggggggfffffffffffffffff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27277|max=49456&chxp=1,1,55,100&chtt=Rogue_Assassination_T11_372+DPS+Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,1,1,5,7,17,17,31,55,74,130,128,196,269,291,368,430,514,615,628,661,686,617,606,628,565,495,406,340,298,235,192,141,108,76,52,30,23,23,11,8,10,9,1,0,0,0,1&chds=0,686&chbh=5&chxt=x&chxl=0:|min=24919|avg=27277|max=29882&chxp=0,1,48,100&chtt=Rogue_Assassination_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Assassination_T11_372 27277
backstab 2469 9.1% 76.4 2.08sec 14621 14307 8263 19705 25502 59.1% 4.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
76.36 76.36 0.00 0.00 1.0219 0.0000 1116426
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 36.11% 8263.46 7521 10724 227835
crit 45.1 59.05% 19705.09 17886 25502 888591
dodge 3.7 4.84% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
deadly_poison 2848 10.4% 346.4 1.30sec 3717 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150 8023 12394 13.1% 0.0% 99.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
346.43 1.02 149.81 149.81 0.0000 3.0000 1287612
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 130.2 86.91% 8022.72 1449 10870 1044514
crit 19.6 13.09% 12393.67 2239 16794 243098

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
envenom 3935 14.4% 62.9 7.15sec 28281 27505 20418 43343 63153 38.7% 4.9% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
62.92 62.92 0.00 0.00 1.0282 0.0000 1779516
Direct Results Count Pct Average Min Max Total Damage
hit 35.5 56.44% 20417.87 10245 30657 725082
crit 24.3 38.66% 43342.76 17588 63153 1054434
dodge 3.1 4.90% 0.00 0 0 0

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deadly Poison application chance increased by $s3%. Instant Poison application frequency increased by $s2%.
  • description:Finishing move that consumes your Deadly Poison and deals instant poison damage. Following the Envenom attack your Deadly Poison application chance is increased by $s3%, and your Instant Poison application frequency by $s2%, for 1 sec plus an additional 1 sec per combo point. Poison doses, up to the number of combo points spent, are consumed to increase Envenom's damage: 1 point : ${$AP*0.09*$+($m1*1)} damage 2 points: Up to ${$AP*0.18*$+($m1*2)} damage 3 points: Up to ${$AP*0.27*$+($m1*3)} damage 4 points: Up to ${$AP*0.36*$+($m1*4)} damage 5 points: Up to ${$AP*0.45*$+($m1*5)} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.450000
  • base_dd_min:1203.99
  • base_dd_max:1203.99
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
garrote 160 0.6% 3.8 128.54sec 19016 18337 0 0 0 0.0% 4.8% 0.0% 0.0% 21 2612 5419 27.2% 0.0% 14.2%

Stats details: garrote

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.79 3.79 21.37 21.37 1.0370 3.0000 72151
Direct Results Count Pct Average Min Max Total Damage
hit 3.6 95.20% 0.00 0 0 0
dodge 0.2 4.80% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 15.6 72.78% 2612.10 2341 3420 40629
crit 5.8 27.22% 5418.95 4823 7389 31521

Action details: garrote

Static Values
  • id:703
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:45.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 damage every $t1 seconds.
  • description:Garrote the enemy, silencing them for $1330d and causing ${($m1+$AP*$*0.07)*6} damage over $d, increased by your attack power. Must be stealthed and behind the target. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.070000
  • base_td:132.78
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 6656 24.4% 673.0 0.70sec 4472 0 4175 6449 8655 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
672.98 672.98 0.00 0.00 0.0000 0.0000 3009718
Direct Results Count Pct Average Min Max Total Damage
hit 585.0 86.92% 4174.82 3736 5602 2442210
crit 88.0 13.08% 6449.25 5773 8655 567508

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 3220 11.8% 461.3 0.98sec 3157 3223 2977 6166 8086 26.9% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
461.30 461.30 0.00 0.00 0.9794 0.0000 1456200
Direct Results Count Pct Average Min Max Total Damage
hit 149.4 32.38% 2977.35 2695 3925 444751
crit 123.9 26.85% 6166.03 5551 8086 763834
glance 110.6 23.98% 2238.10 2021 2944 247614
dodge 22.4 4.85% 0.00 0 0 0
miss 55.0 11.93% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1608 5.9% 592.2 0.76sec 1228 1609 1158 2399 3146 26.8% 16.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
592.23 592.23 0.00 0.00 0.7631 0.0000 727269
Direct Results Count Pct Average Min Max Total Damage
hit 191.9 32.39% 1158.14 1048 1527 222190
crit 158.9 26.84% 2399.07 2160 3146 381328
glance 142.1 24.00% 870.82 786 1145 123751
dodge 28.8 4.87% 0.00 0 0 0
miss 70.5 11.90% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 2970 10.9% 79.4 3.65sec 16903 16508 0 0 0 0.0% 4.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
79.45 79.45 0.00 0.00 1.0240 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 75.6 95.18% 0.00 0 0 0
dodge 3.8 4.82% 0.00 0 0 0

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
mutilate_mh 1980 7.3% 75.6 3.83sec 11842 0 7182 17146 22115 46.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.62 75.62 0.00 0.00 0.0000 0.0000 895469
Direct Results Count Pct Average Min Max Total Damage
hit 40.2 53.23% 7181.80 6476 9300 289057
crit 35.4 46.77% 17146.27 15399 22115 606412

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
mutilate_oh 989 3.6% 75.6 3.83sec 5917 0 3584 8561 11034 46.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.62 75.62 0.00 0.00 0.0000 0.0000 447424
Direct Results Count Pct Average Min Max Total Damage
hit 40.2 53.12% 3584.12 3230 4640 143971
crit 35.4 46.88% 8560.92 7680 11034 303454

Action details: mutilate_oh

Static Values
  • id:5374
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Damage is increased by 20% against Poisoned targets. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:201.42
  • base_dd_max:201.42
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
rupture 673 2.5% 28.5 16.05sec 10692 10462 0 0 0 0.0% 4.9% 0.0% 0.0% 217 1093 2256 26.8% 0.0% 95.9%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 216.72 216.72 1.0220 2.0000 304408
Direct Results Count Pct Average Min Max Total Damage
hit 27.1 95.14% 0.00 0 0 0
dodge 1.4 4.86% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 158.7 73.22% 1093.22 572 1765 173473
crit 58.0 26.78% 2255.96 1178 3636 130935

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.024000
  • base_td:182.29
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 1.0 229.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 0.00 0.00 1.0050 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds
venomous_wound 2738 10.0% 142.9 3.14sec 8665 0 8089 12496 16875 13.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.85 142.85 0.00 0.00 0.0000 0.0000 1237858
Direct Results Count Pct Average Min Max Total Damage
hit 124.2 86.93% 8089.22 7280 10923 1004478
crit 18.7 13.07% 12495.54 11247 16875 233379

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.176000
  • base_dd_min:675.14
  • base_dd_max:675.14

Resources

Resource Usage Type Res% DPR RPE
Rogue_Assassination_T11_372
backstab energy 38.0% 243.7 60
envenom energy 18.3% 808.0 35
garrote energy 1.4% 422.6 45
mutilate energy 36.2% 307.3 55
rupture energy 5.9% 427.7 25
slice_and_dice energy 0.2% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 45.1 225.5 5.0 0.0%
cold_blood energy 4.1 102.0 24.8 0.7%
energy_refund energy 192.7 621.6 3.2 2.1%
energy_regen energy 1808.8 5364.1 3.0 0.5%
murderous_intent energy 72.7 2180.0 30.0 0.0%
overkill energy 299.4 292.6 1.0 2.8%
relentless_strikes energy 71.9 1797.1 25.0 0.0%
venomous_vim energy 142.9 1413.5 9.9 1.1%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
cold_blood 4.1 0.0 124.7sec 124.7sec 0% 0%

Database details

  • id:
  • cooldown name:buff_cold_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:120.00
  • default_chance:100.00%
deadly_proc 341.3 0.0 1.3sec 1.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
envenom 53.9 9.0 8.3sec 7.1sec 73% 75%

Database details

  • id:
  • cooldown name:buff_envenom
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.5 7.2 38.9sec 23.4sec 39% 40%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.9 45.8sec 31.5sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overkill 3.8 0.0 128.5sec 128.5sec 17% 17%

Database details

  • id:
  • cooldown name:buff_overkill
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 1.0 345.4 308.0sec 1.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.7sec 78.7sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
slice_and_dice 1.0 59.8 149.4sec 7.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:21.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.1 0.6 50.2sec 46.1sec 8% 13%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.5sec 423.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 2.8 0.0 182.3sec 182.3sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
vendetta 4.3 0.0 120.3sec 120.3sec 27% 100%

Database details

  • id:
  • cooldown name:buff_vendetta
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.5%
poisoned 100.0%

Procs

Count Interval
combo_points 379.6 2.2sec
combo_points_wasted 17.6 24.4sec
deadly_poisons 346.4 1.3sec
ruthlessness 52.7 8.6sec
seal_fate 99.4 4.5sec
venomous_wounds 142.9 3.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.10%
σ of the average dps 5.9791
2 * σ / μ 0.0438%
95% Confidence Intervall ( μ ± 2σ ) ( 27265.31 - 27289.23 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27259.33 - 27295.21 )
Sample Data
σ 597.9059
Minimum 24919.48
Maximum 29881.89
Spread ( max - min ) 4962.41
Range ( max - min ) / 2 2481.21
Range% 9.10
10th Percentile 26536.13
90th Percentile 28070.24
( 90th Percentile - 10th Percentile ) 1534.11
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1921
0.1 scale factor error with delta=300 3177
0.05 scale factor error with delta=300 12710
0.01 scale factor error with delta=300 317770
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 garrote
A slice_and_dice,if=buff.slice_and_dice.down
B rupture,if=!ticking&time<6
C vendetta
D rupture,if=!ticking&buff.slice_and_dice.remains>6
E cold_blood,sync=envenom
F envenom,if=combo_points>=4&buff.envenom.down
G envenom,if=combo_points>=4&energy>90
H envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
I backstab,if=combo_points<5&target.health_pct<35
J mutilate,if=combo_points<4&target.health_pct>=35
K vanish,if=time>30&energy>50

Sample Sequence

01245689ABBCJEFJGJGJJGJDJJJJFJJGJJFK9DJJFJFJDJFJFJFJDJJFGJJDJFJJFJJDJFJFJFJFJJDJCJEFJFJDJJFJJJFJDJJFJFJDJJFJ8FGJDJJFJFGJDJFJK9JFJDJFGJJFJJFJCDJJEFJFJDDJJFJJFDJFJJDJJFJJFDJFJJDJJFJJFJDJJFIIIF8DIICFIIFDIIIEFIIIFDIIFIIIK9FDDIIGIIIGIIGIIGIIGIIIDIIIFIIIFIDIIFIIFDIIIFIIGIIIGGIIDIIIFIIFIIFCIDIIIFIIIEFIIDIIIFIIF4IIIFIDIIFIIFIDDIIF8II

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 13.01% 13.01% 1333
Spell Crit 9.88% 4.88% 874
Spell Haste 16.59% 11.03% 1413
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 15656 11048 190
Melee Hit 11.10% 11.10% 1333
Melee Crit 29.90% 20.89% 874
Melee Haste 11.03% 11.03% 1413
Expertise 6.56 6.56 197
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.76% 17.76% 1749

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 3
Lethality 3
Ruthlessness 3
Quickening 2
Puncturing Wounds 3
Blackjack 0
Deadly Brew 1
Cold Blood 1
Vile Poisons 3
Deadened Nerves 0
Seal Fate 2
Murderous Intent 2
Overkill 1
Master Poisoner 1
Improved Expose Armor 0
Cut to the Chase 3
Venomous Wounds 2
Vendetta 1
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 2
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 3
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Assassination_T11_372
origin="http://chardev.org/?profile=36311"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-033323011302211032100200000000000000002030030000000000000
glyphs=expose_armor/mutilate/backstab/rupture
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/garrote
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/rupture,if=!ticking&time<6
actions+=/vendetta
actions+=/rupture,if=!ticking&buff.slice_and_dice.remains>6
actions+=/cold_blood,sync=envenom
actions+=/envenom,if=combo_points>=4&buff.envenom.down
actions+=/envenom,if=combo_points>=4&energy>90
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/backstab,if=combo_points<5&target.health_pct<35
actions+=/mutilate,if=combo_points<4&target.health_pct>=35
actions+=/vanish,if=time>30&energy>50
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_mastery,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_mastery,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,reforge=exp_hit,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_hit,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=haste_mastery,gems=40agi_67agi_10haste,enchant=65mastery
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=exp_hit,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=themios_the_darkbringer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81mastery_181sta,reforge=crit_hit,weapon=bow_2.90speed_1428min_2653max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=197
# gear_hit_rating=1333
# gear_crit_rating=874
# gear_haste_rating=1413
# gear_mastery_rating=1749
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=themios_the_darkbringer,heroic=1,weapon=bow_2.90speed_1428min_2653max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Combat_T11_372 : 26792dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26791.5 11.47 / 0.04% 1009.1 26.5 26.4 energy 24.68% 45.7
Origin http://chardev.org/?profile=55921
Talents http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
Glyphs
  • expose_armor
  • slice_and_dice
  • sinister_strike
  • adrenaline_rush

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:56204|30116|23136|10563|8081|4556|3976&chds=0,112408&chco=C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++56204++killing_spree,C79C6E,0,0,15|t++30116++eviscerate,C79C6E,1,0,15|t++23136++rupture,C55D54,2,0,15|t++10563++sinister_strike,C79C6E,3,0,15|t++8081++revealing_strike,C79C6E,4,0,15|t++4556++melee_main_hand,C79C6E,5,0,15|t++3976++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Combat_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:19,17,15,14,9,8,8,4,3,2,1&chds=0,100&chco=C79C6E,C79C6E,C79C6E,336600,C79C6E,336600,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|melee_main_hand|melee_off_hand|instant_poison|main_gauche|deadly_poison|eviscerate|rupture|revealing_strike|killing_spree_mh|killing_spree_oh&chtt=Rogue_Combat_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:o82wrou0yvqoonlkjjkkllqrpprvy012466655664yspolhecaYWVUTTTTTTSTTTTTTUUUUUUUTTTTUUUUUUTTTTTTTTTTSSSSSSSTTTUUVVWXYZacdefghijjjjjjjjjiihgfecbaZYYXWVVUUTTTSSSSSSSSSSSSSTTTTTTTTTTTTSSSSSSTUUUUVVVWWWWWXXYZaabcdeffghijjjkkjjjiihgfdcbaZYXWWVUUUTTTTTTTTTTUUUUUUUUUUUUUTTTTTTTSSSSSSSSSSTTTTUUUVWWXYZabbcdefgghhiiiiihhhggfeeddccbbaaZYYXWWVVVUUUTTTTTTTSSSSSSSSSSSSSSSSSSSSSSTUUVWWXYYZZZZaabbcddeffghhiijkklllllkkjjhgfedcbaYYXWWVUUTTTTTTTSSSSSSSSTSSSSSSSSSSSSSSSTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=84&chtt=Rogue_Combat_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwxyz01244566666777654210zyxwvuuuuuuutssrrrrqqponmlkkjihhgggfffffffffggghhiiiijjjjjkkkkjjjjiiihhggggfffffggghijklmnoppqrrsssssssrrqpponmllkjiihhggggggggghhhhiiiiiiiiiihhhhhgggggggggghhhijjklmmnnoopppppqqqqqqpppppoooonnnnmmmmllllkkkkjjjjiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiijjkkllmnnooppqqqqrrqqqqppooonmmllkkkjjjiiiiiiiiiiiiihhhhhhgggggffffffgggghhhiijjkklmnnoooppqqqqqrrrrrrrrrrrrqqqqqqpppoooonnmmllkkjjiiihhhggggfffffffffggggggghhhhhhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26792|max=42285&chxp=1,1,63,100&chtt=Rogue_Combat_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,2,3,4,13,31,31,44,78,85,121,184,214,255,299,384,462,463,545,538,610,595,563,597,526,516,485,401,368,317,249,222,175,146,139,80,75,60,26,28,22,15,11,6,5,1,1,1,1&chds=0,610&chbh=5&chxt=x&chxl=0:|min=24828|avg=26792|max=29085&chxp=0,1,46,100&chtt=Rogue_Combat_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Combat_T11_372 26792
deadly_poison 2160 8.1% 187.6 2.40sec 5205 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148 6135 9482 13.4% 0.0% 98.4%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
187.61 2.80 148.29 148.29 0.0000 3.0000 976467
Direct Results Count Pct Average Min Max Total Damage
hit 2.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 128.3 86.56% 6135.05 989 9733 787429
crit 19.9 13.44% 9482.10 1528 15038 189038

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2125 7.9% 31.3 14.32sec 30691 30116 21275 43738 58658 41.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.30 31.30 0.00 0.00 1.0191 0.0000 960725
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 58.08% 21275.14 13135 28475 386801
crit 13.1 41.92% 43737.56 27058 58658 573924

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 3722 13.9% 484.6 0.99sec 3473 0 3249 5020 7747 13.4% 0.4% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
484.59 484.59 0.00 0.00 0.0000 0.0000 1683085
Direct Results Count Pct Average Min Max Total Damage
hit 417.7 86.21% 3248.92 2549 5014 1357215
crit 64.9 13.40% 5020.10 3938 7747 325869
miss 1.9 0.40% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
killing_spree 911 3.4% 7.3 63.54sec 56605 56204 0 0 0 0.0% 0.0% 0.0% 0.0% 36 0 0 0.0% 0.0% 4.0%

Stats details: killing_spree

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.28 7.28 36.28 0.00 1.0071 0.5000 0
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 100.00% 0.00 0 0 0

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:energy
  • tree:combat
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every $t1 sec with both weapons until 5 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 576 2.2% 36.3 11.35sec 7179 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 5547 11481 27.5% 0.0% 0.0%

Stats details: killing_spree_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.28 0.00 0.00 36.28 0.0000 0.0000 260494
Tick Results Count Pct Average Min Max Total Damage
hit 26.3 72.49% 5546.68 3854 7367 145894
crit 10.0 27.51% 11481.40 7938 15176 114599

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 335 1.3% 36.3 11.35sec 4177 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3229 6685 27.4% 0.0% 0.0%

Stats details: killing_spree_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.28 0.00 0.00 36.28 0.0000 0.0000 151543
Tick Results Count Pct Average Min Max Total Damage
hit 26.3 72.59% 3229.22 2235 4327 85053
crit 9.9 27.41% 6685.24 4604 8913 66491

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 2471 9.2% 178.2 2.53sec 6272 0 4864 10043 15176 27.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
178.17 178.17 0.00 0.00 0.0000 0.0000 1117510
Direct Results Count Pct Average Min Max Total Damage
hit 129.7 72.81% 4863.92 3854 7367 630933
crit 48.5 27.19% 10042.52 7938 15176 486577

Action details: main_gauche

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 4551 17.0% 360.8 1.26sec 5704 4556 5133 10606 16163 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
360.76 360.76 0.00 0.00 1.2520 0.0000 2057652
Direct Results Count Pct Average Min Max Total Damage
hit 132.8 36.80% 5133.08 4088 7846 681545
crit 98.3 27.24% 10606.06 8422 16163 1042383
glance 86.6 23.99% 3855.27 3066 5885 333725
miss 43.1 11.96% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3975 14.8% 668.8 0.68sec 2687 3976 2419 4999 7617 27.2% 12.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
668.75 668.75 0.00 0.00 0.6758 0.0000 1797198
Direct Results Count Pct Average Min Max Total Damage
hit 246.0 36.78% 2419.06 1927 3697 594970
crit 182.1 27.23% 4998.56 3969 7617 910315
glance 160.7 24.02% 1816.92 1445 2773 291914
miss 80.0 11.97% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
revealing_strike 683 2.5% 37.4 11.99sec 8248 8081 6394 13210 16836 27.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: revealing_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
37.44 37.44 0.00 0.00 1.0207 0.0000 308824
Direct Results Count Pct Average Min Max Total Damage
hit 27.3 72.80% 6393.67 5110 8173 174269
crit 10.2 27.20% 13210.43 10527 16836 134555

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Reveals a weakness, increasing the effectiveness of the rogue's next finishing move by $s3%.
  • description:An instant strike that causes $m1% of your normal weapon damage and increases the effectiveness of your next offensive finishing move on that target by $s3% for $d. Awards 1 combo point.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 999 3.7% 19.2 23.34sec 23590 23136 0 0 0 0.0% 0.0% 0.0% 0.0% 153 2294 4739 27.2% 0.0% 67.5%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.15 19.15 152.68 152.68 1.0196 2.0000 451780
Direct Results Count Pct Average Min Max Total Damage
hit 19.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 111.1 72.80% 2294.03 1464 3178 254970
crit 41.5 27.20% 4738.54 3015 6546 196810

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
sinister_strike 5195 19.4% 218.7 2.07sec 10740 10563 7435 17706 22617 32.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
218.69 218.69 0.00 0.00 1.0167 0.0000 2348768
Direct Results Count Pct Average Min Max Total Damage
hit 148.3 67.82% 7435.22 6012 9511 1102786
crit 70.4 32.18% 17705.75 14296 22617 1245982

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:39.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:200.29
  • base_dd_max:200.29
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slice_and_dice 0 0.0% 16.1 28.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.14 16.14 0.00 0.00 1.0187 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 16.1 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Combat_T11_372
eviscerate energy 9.1% 876.9 35
revealing_strike energy 12.5% 206.2 40
rupture energy 4.0% 943.6 25
sinister_strike energy 71.0% 275.4 39
slice_and_dice energy 3.4% 0.0 25
Resource Gains Type Count energy Average Overflow
adrenaline_rush energy 417.0 1455.5 3.5 6.9%
combat_potency energy 153.4 2237.2 14.6 2.7%
energy_regen energy 1808.8 6764.5 3.7 1.5%
relentless_strikes energy 59.2 1480.5 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.3 0.0 88.4sec 88.4sec 23% 34%

Database details

  • id:
  • cooldown name:buff_adrenaline_rush
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
berserking 3.0 0.0 180.4sec 180.4sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 173.1 0.0 2.5sec 2.5sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
killing_spree 7.3 0.0 63.6sec 63.6sec 3% 39%

Database details

  • id:
  • cooldown name:buff_killing_spree
  • tooltip:(null)
  • max_stacks:1
  • duration:2.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 13.4 13.6 33.7sec 16.3sec 51% 53%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.6 4.1 45.2sec 30.8sec 30% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
poison_doses 2.8 184.1 145.3sec 2.4sec 99% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.4sec 78.4sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
revealing_strike 37.4 0.0 12.0sec 12.0sec 15% 85%

Database details

  • id:
  • cooldown name:buff_revealing_strike
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 1.3 14.8 223.0sec 28.8sec 100% 100%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:40.50
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 7.8 1.3 52.7sec 44.6sec 14% 20%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.5sec 423.5sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
deep_insight 41.2%
energy_cap 1.9%
moderate_insight 20.1%
shallow_insight 20.5%

Procs

Count Interval
combo_points 300.0 1.8sec
combo_points_wasted 1.3 117.4sec
deadly_poisons 187.6 2.4sec
main_gauche 178.2 2.5sec
sinister_strike_glyph 43.8 10.2sec

Statistics & Data Analysis

DPS
Population
Convergence 70.51%
σ of the average dps 5.7370
2 * σ / μ 0.0428%
95% Confidence Intervall ( μ ± 2σ ) ( 26780.04 - 26802.99 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26774.31 - 26808.73 )
Sample Data
σ 573.6991
Minimum 24827.93
Maximum 29085.38
Spread ( max - min ) 4257.45
Range ( max - min ) / 2 2128.72
Range% 7.95
10th Percentile 26081.24
90th Percentile 27556.85
( 90th Percentile - 10th Percentile ) 1475.61
Approx. Iterations needed for
1% dps error 18
0.1% dps error 1834
0.1 scale factor error with delta=300 2925
0.05 scale factor error with delta=300 11702
0.01 scale factor error with delta=300 292560
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 kick
7 berserking
8 slice_and_dice,if=buff.slice_and_dice.down
9 slice_and_dice,if=buff.slice_and_dice.remains<2
A killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
B adrenaline_rush,if=energy<35
C eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
D rupture,if=!ticking&combo_points=5&target.time_to_die>10
E eviscerate,if=combo_points=5
F revealing_strike,if=combo_points=4&buff.revealing_strike.down
G sinister_strike,if=combo_points<5

Sample Sequence

012457G8GGGGFDGGGGFAEGGGBCGGGGF9GGGGGDGGGFEGGGFEGGGCGGGFDGGG9GAGGGFDGGGFEGGGGFDG9GGGFBEGGGFDGGGGFEGG9GGGFCGGGGAFDGGGGEGG9GGGFDGGGCGGGG9GGG7GFDGGGFEGAGBGFDGGGGFCGGGGFCG9GGGGFDGGGFEGGGF9GGGGDGGGGFEGAGGFDGGGFEG9GGGGGBCGGGFDGGG9GGGFEGGGFCGGGGFACGGGFDGGG9GGGEGGGFDGGGGFEGG79GGGGDGGBGFEGGGGFCGGGFDGG9GGAGGFEGGGGFDGGGFCGGG9GGGGFDGGGGFEGGGGDG8AGGGBGCGGGFCGGGGDGGGFEG9GGGGFEGGGGFDGGGG9GGGGDG4AGGGFEGGGGGCGGG7F

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 6597 5297 4837
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 10.60% 10.60% 1086
Spell Crit 10.24% 5.24% 940
Spell Haste 18.83% 13.17% 1687
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20352 14362 190
Melee Hit 9.04% 9.04% 1086
Melee Crit 30.27% 21.26% 940
Melee Haste 13.17% 13.17% 1687
Expertise 26.01 26.01 781
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.41% 18.74% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.90% 13.90% 1057

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 2
Puncturing Wounds 0
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 2
Improved Sinister Strike 3
Precision 3
Improved Slice and Dice 2
Improved Sprint 2
Aggression 3
Improved Kick 0
Lightning Reflexes 3
Revealing Strike 1
Reinforced Leather 0
Improved Gouge 0
Combat Potency 3
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 1
Savage Combat 2
Bandit's Guile 3
Restless Blades 2
Killing Spree 1
Subtlety Rank
Nightstalker 0
Improved Ambush 0
Relentless Strikes 3
Elusiveness 0
Waylay 0
Opportunity 0
Initiative 0
Energetic Recovery 0
Find Weakness 0
Hemorrhage 0
Honor Among Thieves 0
Premeditation 0
Enveloping Shadows 0
Cheat Death 0
Preparation 0
Sanguinary Vein 0
Slaughter from the Shadows 0
Serrated Blades 0
Shadow Dance 0

Profile

#!./simc

rogue=Rogue_Combat_T11_372
origin="http://chardev.org/?profile=55921"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023020000000000000023322303100300123210030000000000000000
glyphs=expose_armor/slice_and_dice/sinister_strike/adrenaline_rush
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/kick
actions+=/berserking
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/eviscerate,if=combo_points=5&buff.bandits_guile.stack>=12
actions+=/rupture,if=!ticking&combo_points=5&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5
actions+=/revealing_strike,if=combo_points=4&buff.revealing_strike.down
actions+=/sinister_strike,if=combo_points<5
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=20agi_20hit_10agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_zephyr,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238haste_238mastery,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=202
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=35agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=crit_hit,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,reforge=hit_exp,gems=40agi_67agi_10haste,enchant=50exp
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,suffix=136
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_exp,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_exp,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_hit,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4837
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=1086
# gear_crit_rating=940
# gear_haste_rating=1687
# gear_mastery_rating=1057
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Rogue_Subtlety_T11_372 : 26686dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26685.6 9.45 / 0.04% 1202.2 22.2 22.1 energy 34.48% 46.2
Origin http://chardev.org/?profile=36352
Talents http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
Glyphs
  • expose_armor
  • backstab
  • shadow_dance
  • slice_and_dice

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:116997|34062|26105|25225|4694|2344&chds=0,233995&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++116997++rupture,C55D54,0,0,15|t++34062++ambush,C79C6E,1,0,15|t++26105++eviscerate,C79C6E,2,0,15|t++25225++backstab,C79C6E,3,0,15|t++4694++melee_main_hand,C79C6E,4,0,15|t++2344++melee_off_hand,C79C6E,5,0,15&chtt=Rogue_Subtlety_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x280&cht=p&chf=bg,s,333333&chd=t:31,18,11,11,9,8,7,5&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,336600,336600,C55D54&chl=backstab|melee_main_hand|ambush|eviscerate|melee_off_hand|instant_poison|deadly_poison|rupture&chtt=Rogue_Subtlety_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:k80mtmYdWUVcifnoroeiadbfbgrsqzzrlekhgfhptjXdZYZXbfeXdXbmkbcfXefnuuqjcZYSSWbXdaahkfcgagedccfhfZdacggbceZdacaeehdadadeeZdcbdccbhkrusngZWTSVXZZbbcfdebcbdcdcacbcbebefeecddgegefgfedebededfefgfhinqsqnhcZWVWYYaabccdcdcecccdddededdcdddeceddddccccdcedfefeefefgjmoppmieaXWXXZZbcdddededdcccbcbcbccdccccdcdcdcddddcdcdccccccdeghlnoonkhdaYYYYabcddeddddccccdcdcdcdcdccccdcdcdddeeffffgghhhgghijlmmljgdaYXXXYZbccddeeeeeeeeeeeeeeeeeeeddddddcdccccccdcddcccddfhjkmmljgebZY&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=86&chtt=Rogue_Subtlety_T11_372+Energy+Timeline&chts=dddddd,18&chco=C0B84F http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:75653445543231zzwvvuutttstrqoooooopoqqqqqommkjjjiiihgffdeefeffggghiihiiiiijjjiihhghgggffffeeeefeeddddccbcccccccdddccbbccdeffggggghhhhhhijjjjjihggffffeeeddddccccccccccccdddeeeefeffeeeffgghhhiiiiiiiiiijjjjiihhggfffffffffffffffffgggggggfffffeeeeeddeeffghhhiiiiiiiijjjjjiihggfeeedddcccccccccbbbbbbbbccccccccccccccdeefghhhiiiijjkkklllkkjiihggfffeedddccccbcccccdddeeefffggghhhiiijjjkkkkkkkllllllllkkkjjiiiiiiiiiiiiiiiiiiiiiiihhhgggfffeeddddddeeffgghhhhhiijkk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26686|max=47533&chxp=1,1,56,100&chtt=Rogue_Subtlety_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,3,5,0,9,7,18,27,36,54,70,82,108,159,195,265,301,365,414,473,491,467,548,552,630,578,530,525,478,421,375,357,309,250,217,153,137,104,83,62,43,36,24,20,5,8,1,2,2&chds=0,630&chbh=5&chxt=x&chxl=0:|min=24955|avg=26686|max=28375&chxp=0,1,51,100&chtt=Rogue_Subtlety_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Rogue_Subtlety_T11_372 26686
ambush 3012 11.3% 39.1 11.35sec 34798 34062 16707 35624 57105 95.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.14 39.14 0.00 0.00 1.0216 0.0000 1362075
Direct Results Count Pct Average Min Max Total Damage
hit 1.7 4.27% 16706.72 13047 24967 27909
crit 37.5 95.68% 35624.33 26877 57105 1334167
dodge 0.0 0.05% 0.00 0 0 0

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target (${$m2*1.447}% plus ${$m1*$m2/100*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:367.95
  • base_dd_max:367.95
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
backstab 8199 30.7% 142.9 3.08sec 25953 25225 13165 31424 46055 70.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
142.85 142.85 0.00 0.00 1.0289 0.0000 3707460
Direct Results Count Pct Average Min Max Total Damage
hit 42.7 29.87% 13165.09 11839 19367 561746
crit 100.1 70.08% 31424.26 28152 46055 3145713
dodge 0.1 0.05% 0.00 0 0 0

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • tree:combat
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.35
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus ${$m1*$m2/100} to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:345.44
  • base_dd_max:345.44
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
deadly_poison 1928 7.2% 167.0 2.70sec 5222 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147 5487 8477 14.6% 0.0% 97.6%

Stats details: deadly_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
167.00 3.83 147.19 147.19 0.0000 3.0000 872060
Direct Results Count Pct Average Min Max Total Damage
hit 3.8 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.7 85.37% 5487.31 1079 7345 689483
crit 21.5 14.63% 8476.96 1667 11348 182578

Action details: deadly_poison

Static Values
  • id:2818
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $2823h% chance of poisoning the enemy for ${$2818m1*4} Nature damage over $2818d. Stacks up to 5 times on a single target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.035000
  • base_td:135.03
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
eviscerate 2950 11.1% 49.8 8.92sec 26784 26105 18036 37153 52612 45.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
49.80 49.80 0.00 0.00 1.0260 0.0000 1333875
Direct Results Count Pct Average Min Max Total Damage
hit 27.0 54.14% 18036.15 15278 25540 486312
crit 22.8 45.81% 37152.80 31472 52612 847563
dodge 0.0 0.05% 0.00 0 0 0

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.091)*$}-${$M1+(($b1*1)+$AP*0.091)*$} damage 2 points: ${$m1+(($b1*2)+$AP*0.182)*$}-${$M1+(($b1*2)+$AP*0.182)*$} damage 3 points: ${$m1+(($b1*3)+$AP*0.273)*$}-${$M1+(($b1*3)+$AP*0.273)*$} damage 4 points: ${$m1+(($b1*4)+$AP*0.364)*$}-${$M1+(($b1*4)+$AP*0.364)*$} damage 5 points: ${$m1+(($b1*5)+$AP*0.455)*$}-${$M1+(($b1*5)+$AP*0.455)*$} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.455000
  • base_dd_min:2861.45
  • base_dd_max:3228.28
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
instant_poison 2126 8.0% 314.8 1.43sec 3054 0 2935 4534 5846 14.1% 3.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: instant_poison

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
314.77 314.77 0.00 0.00 0.0000 0.0000 961306
Direct Results Count Pct Average Min Max Total Damage
hit 259.1 82.31% 2934.65 2781 3784 760310
crit 44.3 14.09% 4533.51 4296 5846 200995
miss 11.4 3.61% 0.00 0 0 0

Action details: instant_poison

Static Values
  • id:8680
  • school:nature
  • resource:mana
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Coats a weapon with poison that lasts for 1 hour. Each strike has a $8679h% chance of poisoning the enemy which instantly inflicts $8680s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.090000
  • base_dd_min:302.89
  • base_dd_max:401.50
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4690 17.6% 510.1 0.89sec 4158 4694 3554 7385 10605 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
510.05 510.05 0.00 0.00 0.8859 0.0000 2120941
Direct Results Count Pct Average Min Max Total Damage
hit 131.1 25.69% 3554.19 3091 5148 465804
crit 179.7 35.24% 7384.89 6368 10605 1327425
glance 122.3 23.99% 2678.55 2319 3861 327713
dodge 0.3 0.06% 0.00 0 0 0
miss 76.6 15.02% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 2343 8.8% 655.3 0.69sec 1617 2344 1383 2872 4125 35.2% 15.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
655.31 655.31 0.00 0.00 0.6897 0.0000 1059584
Direct Results Count Pct Average Min Max Total Damage
hit 168.5 25.71% 1382.98 1203 2003 233031
crit 230.7 35.20% 2872.01 2477 4125 662513
glance 157.4 24.02% 1041.95 902 1502 164040
dodge 0.4 0.06% 0.00 0 0 0
miss 98.3 15.01% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recuperate 0 0.0% 14.9 30.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recuperate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
14.87 14.87 0.00 0.00 1.0191 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 14.9 100.00% 0.00 0 0 0

Action details: recuperate

Static Values
  • id:73651
  • school:physical
  • resource:energy
  • tree:combat
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Recovering $w1 health every $t1 sec.
  • description:Finishing move that consumes combo points on any nearby target to restore $?s79008[4]?s79007[3.5][3]% of maximum health every $t1 sec. Lasts longer per combo point: 1 point : 6 seconds 2 points: 12 seconds 3 points: 18 seconds 4 points: 24 seconds 5 points: 30 seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3.00
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rupture 1437 5.4% 5.5 87.62sec 119118 116997 0 0 0 0.0% 0.1% 0.0% 0.0% 220 2155 4452 35.1% 0.0% 97.1%

Stats details: rupture

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.46 5.46 219.51 219.51 1.0181 2.0000 650026
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 99.95% 0.00 0 0 0
dodge 0.0 0.05% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 142.5 64.91% 2155.24 2058 2750 307111
crit 77.0 35.09% 4452.35 4238 5665 342915

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • tree:assassination
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$*1+0.015*$AP*$)*0.5*$} damage over $ seconds 2 points: ${($m1+$b1*$*2+0.024*$AP*$)*0.5*$} damage over $ seconds 3 points: ${($m1+$b1*$*3+0.03*$AP*$)*0.5*$} damage over $ seconds 4 points: ${($m1+$b1*$*4+0.03428571*$AP*$)*0.5*$} damage over $ seconds 5 points: ${($m1+$b1*$*5+0.0375*$AP*$)*0.5*$} damage over $ seconds
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.037500
  • base_td:243.05
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slice_and_dice 0 0.0% 17.3 26.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.31 17.31 0.00 0.00 1.0241 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 17.3 100.00% 0.00 0 0 0

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • tree:assassination
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w1%.
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : ${(9+$)*(100+$)/100} seconds 2 points: ${(12+$)*(100+$)/100} seconds 3 points: ${(15+$)*(100+$)/100} seconds 4 points: ${(18+$)*(100+$)/100} seconds 5 points: ${(21+$)*(100+$)/100} seconds

Resources

Resource Usage Type Res% DPR RPE
Rogue_Subtlety_T11_372
ambush energy 15.6% 869.9 40
backstab energy 56.9% 648.8 40
eviscerate energy 17.4% 765.3 35
recuperate energy 4.4% 0.0 30
rupture energy 1.4% 4764.7 25
slice_and_dice energy 4.3% 0.0 25
Resource Gains Type Count energy Average Overflow
backstab_glyph energy 100.1 500.5 5.0 0.0%
energy_refund energy 175.7 3.9 0.0 0.0%
energy_regen energy 1808.8 5571.5 3.1 0.0%
recuperate energy 143.2 1717.7 12.0 0.0%
relentless_strikes energy 87.4 2185.3 25.0 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.3sec 180.3sec 7% 8%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_proc 142.4 0.0 3.1sec 3.1sec 0% 0%

Database details

  • id:
  • cooldown name:buff_deadly_proc
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
find_weakness 11.7 27.4 40.0sec 11.4sec 37% 100%

Database details

  • id:
  • cooldown name:buff_find_weakness
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 12.0 8.1 37.2sec 21.7sec 41% 42%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.3 3.7 46.8sec 32.5sec 29% 30%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
master_of_subtlety 5.6 0.0 83.3sec 83.3sec 7% 100%

Database details

  • id:
  • cooldown name:buff_master_of_subtlety
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
poison_doses 3.8 157.1 112.9sec 2.8sec 98% 100%

Database details

  • id:
  • cooldown name:buff_poison_doses
  • tooltip:(null)
  • max_stacks:5
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
prestors_talisman_of_machination 6.2 0.0 78.8sec 78.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_prestors_talisman_of_machination
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:75.00
  • default_chance:10.00%
recuperate 6.7 8.2 70.1sec 31.0sec 95% 95%

Database details

  • id:
  • cooldown name:buff_recuperate
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_dance 7.6 0.0 63.2sec 63.2sec 13% 13%

Database details

  • id:
  • cooldown name:buff_shadow_dance
  • tooltip:(null)
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
shadowstep 7.6 0.0 63.5sec 63.5sec 0% 100%

Database details

  • id:
  • cooldown name:buff_shadowstep
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
slice_and_dice 8.6 8.8 53.6sec 26.8sec 97% 99%

Database details

  • id:
  • cooldown name:buff_slice_and_dice
  • tooltip:(null)
  • max_stacks:1
  • duration:27.00
  • cooldown:0.00
  • default_chance:100.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0% 0%

Database details

  • id:
  • cooldown name:buff_stealthed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc 8.8 1.1 47.0sec 41.4sec 11% 17%

Database details

  • id:
  • cooldown name:buff_tier11_4pc
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tolvir_potion 2.0 0.0 423.4sec 423.4sec 10% 10%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
vanish 4.6 0.0 98.6sec 98.6sec 0% 0%

Database details

  • id:
  • cooldown name:buff_vanish
  • tooltip:(null)
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
energy_cap 0.0%

Procs

Count Interval
combo_points 486.1 1.2sec
combo_points_wasted 46.5 13.7sec
deadly_poisons 167.0 2.7sec
hat_donor 303.3 1.5sec
honor_among_thieves 205.2 2.2sec
serrated_blades 49.8 8.9sec

Statistics & Data Analysis

DPS
Population
Convergence 70.80%
σ of the average dps 4.7260
2 * σ / μ 0.0354%
95% Confidence Intervall ( μ ± 2σ ) ( 26676.16 - 26695.06 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26671.43 - 26699.79 )
Sample Data
σ 472.5980
Minimum 24954.87
Maximum 28374.66
Spread ( max - min ) 3419.78
Range ( max - min ) / 2 1709.89
Range% 6.41
10th Percentile 26106.71
90th Percentile 27316.84
( 90th Percentile - 10th Percentile ) 1210.13
Approx. Iterations needed for
1% dps error 12
0.1% dps error 1254
0.1 scale factor error with delta=300 1985
0.05 scale factor error with delta=300 7941
0.01 scale factor error with delta=300 198532
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 apply_poison,main_hand=instant,off_hand=deadly
3 snapshot_stats
4 tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
5 auto_attack
6 stealth
7 kick
8 berserking
9 pool_energy,for_next=1
A shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
B pool_energy,for_next=1
C vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
D shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
E premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
F ambush,if=combo_points<=4
G preparation,if=cooldown.vanish.remains>60
H slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
I rupture,if=combo_points=5&!ticking
J recuperate,if=combo_points=5&remains<3
K eviscerate,if=combo_points=5&dot.rupture.remains>1
L backstab,if=combo_points<3&energy>60
M backstab,if=cooldown.honor_among_thieves.remains>1.75
N backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0

Sample Sequence

0124568DEFHAFFIFFJFFKLLMKMMKLBLMHCEFGKLLJLLMKCFKLMMKLMHMMMK999ADEFJFFKFFKMMHLMMKMMKMMJLMMKLMHLLKLMMK9999ADEFJFFKFHLMMKLMKMMKLLHLMMJLMILLKL8LMKLL99999HADEFKFFJFKLLKLMMKLMHCEFKMMJLLKLMMKMMHLLMKL999999ADFJEFKFFKLMHLLKLMMKLMJMLKLMMHLMKMMKLMMJ999999ADEFKFFHFKLLKLLMKMMJLLHLMMIM8MKLLMKBBBCEFGKLMHL99999999ADFJFFIFKMMKLMHLLMKBBCEFJLMKLMMKLMHMMKLMMKL999999ADFJEFKFHFMKMMKLMKLMMJLMHLLILMMKLLKLMMKM9999999ADFHEFJ4FFILLKLMMKMMHLM8M

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 726 143 20
Agility 8637 6944 4879
Stamina 7515 5899 5785
Intellect 65 62 20
Spirit 92 92 20
Health 145423 122855 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.38% 9.38% 961
Spell Crit 11.43% 6.43% 1152
Spell Haste 20.59% 14.84% 1901
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 20143 14341 190
Melee Hit 8.00% 8.00% 961
Melee Crit 37.73% 27.51% 1152
Melee Haste 14.84% 14.84% 1901
Expertise 25.78 25.78 774
Armor 14965 10889 10889
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 29.69% 23.83% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 11.50% 11.50% 628

Gear

Encoded
head wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
shirt empty
chest wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2 mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1 prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
tabard empty

Talents

Assassination Rank
Deadly Momentum 0
Coup de Grace 2
Lethality 3
Ruthlessness 0
Quickening 0
Puncturing Wounds 3
Blackjack 0
Deadly Brew 0
Cold Blood 0
Vile Poisons 0
Deadened Nerves 0
Seal Fate 0
Murderous Intent 0
Overkill 0
Master Poisoner 0
Improved Expose Armor 0
Cut to the Chase 0
Venomous Wounds 0
Vendetta 0
Combat Rank
Improved Recuperate 0
Improved Sinister Strike 0
Precision 2
Improved Slice and Dice 0
Improved Sprint 0
Aggression 0
Improved Kick 0
Lightning Reflexes 0
Revealing Strike 0
Reinforced Leather 0
Improved Gouge 0
Combat Potency 0
Blade Twisting 0
Throwing Specialization 0
Adrenaline Rush 0
Savage Combat 0
Bandit's Guile 0
Restless Blades 0
Killing Spree 0
Subtlety Rank
Nightstalker 0
Improved Ambush 3
Relentless Strikes 3
Elusiveness 1
Waylay 0
Opportunity 3
Initiative 2
Energetic Recovery 3
Find Weakness 2
Hemorrhage 1
Honor Among Thieves 3
Premeditation 1
Enveloping Shadows 0
Cheat Death 0
Preparation 1
Sanguinary Vein 2
Slaughter from the Shadows 3
Serrated Blades 2
Shadow Dance 1

Profile

#!./simc

rogue=Rogue_Subtlety_T11_372
origin="http://chardev.org/?profile=36352"
level=85
race=troll
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#rogue-023003000000000000000200000000000000000331032321310012321
glyphs=expose_armor/backstab/shadow_dance/slice_and_dice
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/apply_poison,main_hand=instant,off_hand=deadly
actions+=/snapshot_stats
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react|target.time_to_die<30
actions+=/auto_attack
actions+=/stealth
actions+=/kick
actions+=/berserking
actions+=/pool_energy,for_next=1
actions+=/shadow_dance,if=energy>85&combo_points<5&buff.stealthed.down
actions+=/pool_energy,for_next=1
actions+=/vanish,if=time>10&energy>60&combo_points<=1&cooldown.shadowstep.remains<=0&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!buff.find_weakness.up
actions+=/shadowstep,if=buff.stealthed.up|buff.shadow_dance.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=4
actions+=/preparation,if=cooldown.vanish.remains>60
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&!ticking
actions+=/recuperate,if=combo_points=5&remains<3
actions+=/eviscerate,if=combo_points=5&dot.rupture.remains>1
actions+=/backstab,if=combo_points<3&energy>60
actions+=/backstab,if=cooldown.honor_among_thieves.remains>1.75
actions+=/backstab,if=combo_points<5&energy>80&cooldown.honor_among_thieves.remains=0
head=wind_dancers_helmet,heroic=1,type=leather,ilevel=372,quality=epic,stats=325agi_1439armor_257crit_197hit_578sta,reforge=crit_haste,gems=agile_shadowspirit_20agi_20hit_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=mastery_exp
shoulders=wind_dancers_spaulders,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1328armor_171crit_191haste_429sta,reforge=crit_exp,gems=40agi,enchant=50agi_25mastery
chest=wind_dancers_tunic,heroic=1,type=leather,ilevel=372,quality=epic,stats=345agi_1771armor_217exp_257haste_578sta,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=belt_of_the_fallen_brood,heroic=1,type=leather,ilevel=379,quality=epic,stats=266agi_1028armor_204crit_164mastery_458sta,reforge=crit_exp,gems=20agi_20hit_40agi_67agi_20agi
legs=wind_stalker_leggings_of_the_windflurry,heroic=1,type=leather,ilevel=372,quality=epic,stats=1550armor_578sta_345agi_238crit_238haste,reforge=crit_exp,gems=40agi_20agi_20hit_20agi,enchant=190ap_55crit,suffix=200
feet=storm_riders_boots,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1218armor_171haste_191mastery_429sta,reforge=mastery_hit,gems=40agi,enchant=25agi
wrists=parasitic_bands,heroic=1,type=leather,ilevel=372,quality=epic,stats=215agi_775armor_143crit_143mastery_322sta,reforge=mastery_exp,gems=67agi,enchant=50agi
hands=wind_dancers_gloves,heroic=1,type=leather,ilevel=372,quality=epic,stats=266agi_1107armor_191haste_171hit_429sta,gems=40agi_67agi_10haste,enchant=20agi
finger1=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_haste
finger2=mistral_circle_of_the_windflurry,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143crit_143haste,reforge=crit_hit,suffix=135
trinket1=prestors_talisman_of_machination,heroic=1,ilevel=372,quality=epic,stats=363agi,equip=onattackhit_2178haste_10%_15dur_75cd
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,reforge=hit_haste,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=mastery_exp,enchant=22agi
main_hand=organic_lifeform_inverter,heroic=1,ilevel=372,quality=epic,stats=165agi_110exp_110mastery_248sta,reforge=mastery_haste,enchant=landslide,weapon=dagger_1.80speed_751min_1128max
off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=crit_hit,enchant=landslide,weapon=dagger_1.40speed_511min_950max
ranged=dragonheart_piercer,heroic=1,ilevel=372,quality=epic,stats=121agi_81crit_81haste_181sta,reforge=crit_exp,weapon=crossbow_3.00speed_1688min_2533max
# Gear Summary # gear_strength=20
# gear_agility=4879
# gear_stamina=5785
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=774
# gear_hit_rating=961
# gear_crit_rating=1152
# gear_haste_rating=1901
# gear_mastery_rating=628
# gear_armor=10889
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=organic_lifeform_inverter,heroic=1,weapon=dagger_1.80speed_751min_1128max,enchant=landslide
# off_hand=uhnagh_fash_the_darkest_betrayal,heroic=1,weapon=dagger_1.40speed_511min_950max,enchant=landslide
# ranged=dragonheart_piercer,heroic=1,weapon=crossbow_3.00speed_1688min_2533max
# These values represent the avg HAT donor interval of the raid. # A negative value will make the Rogue use a programmed default interval. # A zero value will disable virtual HAT procs and assume a real raid is being simulated. virtual_hat_interval=-1 # A value of 'other' implies some unspecified target. # A value of 'self' implies swapping with another Rogue. tricks_of_the_trade_target=other

Shaman_Elemental_T11_372 : 26591dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26590.7 11.77 / 0.04% 22.0 1207.6 1221.4 mana 0.00% 47.0
Origin http://chardev.org/?profile=14385
Talents http://www.wowhead.com/talent#shaman-303202321223110132120300220000000000000000000000000000000
Glyphs
  • chain_lightning
  • thunder
  • healing_stream_totem
  • thunderstorm
  • astral_recall
  • renewed_life
  • flame_shock
  • lightning_bolt
  • lava_burst

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:39772|31139|13565|7489|4891|3435|620|122&chds=0,79544&chco=C41F3B,C41F3B,336600,336600,C41F3B,C41F3B,C79C6E,C41F3B&chm=t++39772++flame_shock,C41F3B,0,0,15|t++31139++lava_burst,C41F3B,1,0,15|t++13565++lightning_bolt,336600,2,0,15|t++7489++earth_shock,336600,3,0,15|t++4891++fire_nova,C41F3B,4,0,15|t++3435++fire_melee,C41F3B,5,0,15|t++620++earth_melee,C79C6E,6,0,15|t++122++fire_shield,C41F3B,7,0,15&chtt=Shaman_Elemental_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x340&cht=p&chf=bg,s,333333&chd=t:35,19,10,9,7,7,6,2,2,1,1,0,0,0&chds=0,100&chco=336600,C41F3B,336600,336600,C41F3B,C41F3B,C41F3B,336600,C41F3B,C41F3B,C79C6E,C41F3B,C41F3B,C41F3B&chl=lightning_bolt|lava_burst|lightning_bolt_overload|fulmination|flame_shock|searing_totem|lava_burst_overload|earth_shock|fire_melee|fire_nova|earth_melee|fire_blast|darkmoon_card_volcano|fire_shield&chtt=Shaman_Elemental_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:q32zyyyyzz0112223333434444444444444444444555555555555556666766666666555555555554444455555555555556666677777776666666655555555554444444444555555566667777777777766666655555555555555555444444445555666677777766666655555555555555555555555555556666666666666666666665555555555555555555555555556666666666666666666665555555555555555555555556666666666666666666666666665555555544444444555555666666777766666666555555555555555555555555555555555555666666666555555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=117078&chtt=Shaman_Elemental_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:suwy1122222464577865421zywvutttsrqrqpqqrpoonnnmnnnnmmmnmmmmmmnnopoooooonoppppqpqppooonnoopoooonmnnnnmmmnmmnnnmllllkkkjjiihhhhghggffgggghijklmnoppqqrrssssssssrqpponmmllkkjjiiihhgggghhiiiijjjjkkkklllllllkkjjiiiiiiiiijjjkklmmnnoopppppppppoonnmmmllllkkkkjjjiiihhhhhhhhhggggggghhhhhhiiiiijjjkkllmmnnnooooooooonnnmllkkjjiihhhhhhhhiiiijjjjjjkkkkkkkkkjjjjjjjjiiiiiiiiiijjkkllmmnoopqqrrssssssrrqqpoonmllkjjiihhhhhhhgggggggggggggfgggggghhhhiiiijjjkkllmmmmmmmmmmn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26591|max=41579&chxp=1,1,64,100&chtt=Shaman_Elemental_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,3,2,9,13,19,22,50,71,90,131,151,203,261,287,377,388,498,540,570,615,577,583,607,562,569,446,427,356,329,296,228,182,120,115,97,53,52,29,21,17,5,9,5,4,1,3,3,2&chds=0,615&chbh=5&chxt=x&chxl=0:|min=24527|avg=26591|max=28994&chxp=0,1,46,100&chtt=Shaman_Elemental_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Elemental_T11_372 26591
darkmoon_card_volcano 70 0.3% 10.1 47.06sec 3127 0 2722 4206 4493 27.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.07 10.07 0.00 0.00 0.0000 0.0000 31501
Direct Results Count Pct Average Min Max Total Damage
hit 7.3 72.68% 2722.09 2694 2908 19928
crit 2.8 27.32% 4205.58 4162 4493 11573

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
earth_shock 597 2.2% 30.4 14.58sec 8866 7489 6929 14560 20518 25.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.42 30.42 0.00 0.00 1.1840 0.0000 269752
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.62% 6929.47 5948 9817 157311
crit 7.7 25.38% 14560.09 12432 20518 112442

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
elemental_mastery 0 0.0% 6.6 74.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_mastery

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.63 6.63 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.6 100.00% 0.00 0 0 0

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:mana
  • tree:elemental
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Cast time of your next Lightning Bolt, Chain Lightning or Lava Burst spell is reduced by $s1%.
  • description:When activated, your next Lightning Bolt, Chain Lightning or Lava Burst spell becomes an instant cast spell. In addition, your Fire, Frost, and Nature damage is increased by $64701s2%$?s55452[, you take $55452s1% less damage from all sources,][] and you gain $64701s1% spell haste for $64701d.
flame_shock 1831 6.9% 17.7 26.24sec 46679 39772 3853 8083 10516 35.4% 0.0% 0.0% 0.0% 202 2612 5478 35.4% 0.0% 99.6%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
17.73 17.73 202.11 202.11 1.1737 2.2276 827735
Direct Results Count Pct Average Min Max Total Damage
hit 11.5 64.59% 3853.10 3316 5031 44129
crit 6.3 35.41% 8082.66 6930 10516 50755
Tick Results Count Pct Average Min Max Total Damage
hit 130.6 64.62% 2612.19 2226 3429 341129
crit 71.5 35.38% 5477.56 4653 7167 391722

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:9
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 2366 8.9% 30.4 14.58sec 35159 0 27479 57737 87096 25.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.42 30.42 0.00 0.00 0.0000 0.0000 1069673
Direct Results Count Pct Average Min Max Total Damage
hit 22.7 74.62% 27479.41 16522 41673 623862
crit 7.7 25.38% 57737.08 34530 87096 445811

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
lava_burst 5099 19.2% 61.5 7.39sec 37489 31139 0 37591 53923 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
61.48 61.31 0.00 0.00 1.2039 0.0000 2304813
Direct Results Count Pct Average Min Max Total Damage
crit 61.3 100.00% 37590.57 32364 53923 2304813

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.828000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_burst_overload 1511 5.7% 25.3 17.62sec 27036 0 12297 27149 37291 99.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.27 25.20 0.00 0.00 0.0000 0.0000 683148
Direct Results Count Pct Average Min Max Total Damage
hit 0.1 0.25% 12296.84 11086 15411 762
crit 25.1 99.75% 27148.91 22381 37291 682385

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.622000
  • base_dd_min:1047.17
  • base_dd_max:1335.47
lightning_bolt 9394 35.3% 219.8 2.04sec 19316 13565 15122 31820 45637 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
219.83 219.12 0.00 0.00 1.4239 0.0000 4246219
Direct Results Count Pct Average Min Max Total Damage
hit 163.3 74.51% 15122.31 12808 21836 2468873
crit 55.9 25.49% 31820.50 26769 45637 1777347

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.914000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_bolt_overload 2782 10.5% 90.2 4.93sec 13933 0 10908 22960 33007 25.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
90.24 89.93 0.00 0.00 0.0000 0.0000 1257345
Direct Results Count Pct Average Min Max Total Damage
hit 67.0 74.50% 10908.26 9264 15793 730892
crit 22.9 25.50% 22960.11 19361 33007 526452

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.686000
  • base_dd_min:539.17
  • base_dd_max:615.99
searing_totem 1820 6.8% 5.9 60.33sec 138304 137538 0 0 0 0.0% 0.0% 0.0% 0.0% 202 3189 6704 25.4% 0.0% 71.3%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.95 5.95 201.51 201.51 1.0056 1.6000 822647
Direct Results Count Pct Average Min Max Total Damage
hit 5.9 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 150.3 74.59% 3189.42 2741 4281 479408
crit 51.2 25.41% 6703.84 5729 8947 343239

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
pet - fire_elemental 3558
fire_blast 416 11.7% 12.0 9.86sec 4229 0 4105 8212 8974 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 0.0000 0.0000 50752
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.98% 4105.45 3643 4487 47779
crit 0.4 3.02% 8212.41 7285 8974 2973

Action details: fire_blast

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:302.1
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:276.00
  • base_dd_max:321.00
fire_melee 2059 57.9% 23.0 4.93sec 10929 3435 11562 40352 44285 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.00 23.00 0.00 0.00 3.1818 0.0000 251372
Direct Results Count Pct Average Min Max Total Damage
hit 17.4 75.82% 11561.99 10241 12653 201612
crit 0.0 0.21% 40351.60 35842 44285 1921
glance 5.5 23.98% 8674.44 7680 9490 47839

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.135000
  • base_dd_min:427.00
  • base_dd_max:460.00
fire_nova 961 27.0% 12.0 9.86sec 9782 4891 9496 18999 20770 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.00 12.00 0.00 0.00 2.0000 0.0000 117386
Direct Results Count Pct Average Min Max Total Damage
hit 11.6 96.99% 9495.78 8417 10385 110516
crit 0.4 3.01% 18998.72 16834 20770 6870

Action details: fire_nova

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:233.8
  • cooldown:7.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:583.00
  • base_dd_max:663.00
fire_shield 122 3.4% 40.9 3.00sec 365 122 355 710 803 3.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.92 40.92 0.00 0.00 3.0000 0.0000 14947
Direct Results Count Pct Average Min Max Total Damage
hit 39.7 97.02% 354.69 0 401 14081
crit 1.2 2.98% 710.03 0 803 866

Action details: fire_shield

Static Values
  • id:0
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.032000
  • base_dd_min:89.00
  • base_dd_max:89.00
pet - earth_elemental 583
earth_melee 583 100.0% 58.0 2.00sec 1241 620 1279 2559 2640 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.00 58.00 0.00 0.00 2.0000 0.0000 71976
Direct Results Count Pct Average Min Max Total Damage
hit 42.3 73.00% 1279.22 1134 1320 54161
crit 1.7 3.01% 2558.61 2268 2640 4462
glance 13.9 24.00% 959.50 851 990 13354

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Elemental_T11_372
bloodlust mana 0.0% 0.0 1
earth_elemental_totem mana 1.0% 0.0 5623
earth_shock mana 16.8% 2.9 3016
fire_elemental_totem mana 1.0% 0.0 5388
flame_shock mana 9.7% 15.6 2994
lava_burst mana 20.5% 20.6 1818
lightning_bolt mana 40.7% 19.1 1010
searing_totem mana 1.3% 118.1 1171
pet - fire_elemental
fire_blast mana 56.4% 14.0 302
fire_nova mana 43.6% 42.0 233
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 26950.7 14.9 8.6%
flask mana 1.0 5700.0 5700.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 106835.0 106835.0 0.0%
mp5_regen mana 1808.8 97049.7 53.7 8.4%
replenishment mana 1808.8 50815.9 28.1 8.0%
rolling_thunder mana 185.5 370220.0 1996.1 18.4%
pet - fire_elemental mana
initial_mana none 1.0 41650.9 41650.9 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 7%

Database details

  • id:26297
  • cooldown name:buff_berserking
  • tooltip:Attack and casting speed increased.
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 47.0sec 47.0sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
elemental_focus 85.3 53.9 5.3sec 3.2sec 68% 68%

Database details

  • id:16246
  • cooldown name:buff_elemental_focus
  • tooltip:Your next $n damage or healing spells have their mana cost reduced by $s1%.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_mastery 6.6 0.0 74.1sec 74.1sec 22% 24%

Database details

  • id:64701
  • cooldown name:buff_elemental_mastery
  • tooltip:Fire, Frost, and Nature damage increased by $s2%. Casting speed of all spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 9.7 0.0 48.7sec 48.7sec 25% 26%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
theralions_mirror 4.4 0.0 113.1sec 113.1sec 19% 19%

Database details

  • id:
  • cooldown name:buff_theralions_mirror
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
volcanic_potion 1.0 0.0 338.9sec 338.9sec 4% 4%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
fire_elemental-casting 1.0 51.9 0.0sec 2.3sec 98% 98%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:9
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
fulmination_4 2.9 97.2sec
fulmination_5 2.6 100.7sec
fulmination_6 24.9 17.8sec
lava_surge 40.3 11.1sec
rolling_thunder 185.5 2.4sec
wasted_lightning_shield 8.7 44.3sec

Statistics & Data Analysis

DPS
Population
Convergence 70.46%
σ of the average dps 5.8872
2 * σ / μ 0.0443%
95% Confidence Intervall ( μ ± 2σ ) ( 26578.97 - 26602.52 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26573.09 - 26608.41 )
Sample Data
σ 588.7159
Minimum 24526.64
Maximum 28994.17
Spread ( max - min ) 4467.53
Range ( max - min ) / 2 2233.76
Range% 8.40
10th Percentile 25858.90
90th Percentile 27368.53
( 90th Percentile - 10th Percentile ) 1509.63
Approx. Iterations needed for
1% dps error 19
0.1% dps error 1960
0.1 scale factor error with delta=300 3080
0.05 scale factor error with delta=300 12323
0.01 scale factor error with delta=300 308076
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 flametongue_weapon,weapon=main
3 lightning_shield
4 mana_spring_totem
5 wrath_of_air_totem
6 snapshot_stats
7 volcanic_potion,if=!in_combat|buff.bloodlust.react
8 wind_shear
9 bloodlust,health_percentage<=25
A bloodlust,if=target.time_to_die<=60
B berserking
C elemental_mastery
D unleash_elements,moving=1
E flame_shock,if=!ticking|ticks_remain<3
F lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
G earth_shock,if=buff.lightning_shield.stack=9
H earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
I fire_elemental_totem
J earth_elemental_totem
K searing_totem
L spiritwalkers_grace,moving=1
M chain_lightning,if=target.adds>2
N lightning_bolt
O thunderstorm

Sample Sequence

01237ABCEFIJNNNNFNFNFNNNGNNNNFNEFNFNFGNNNNNNFGNNNNNEFNNGNNNFNNNNGNCFNNENNFNFNNGNFNNNNFNHFNNEFNNNFGNNNFNNNGKNFEFNFNNNNFNGNNNNCFENNFNGNNNFNFNFGNNNNNEFNBNNGKNNFNNNGNNFNNENNFNFNFGNNNFNNFHNCNNENNFNNNNNNFNKGNNFNNEFNNNNGNFNNNNNNFHNNNENFNNGNNNFNCNNGNFKNENNFNNNGNFNNFNNFHNNNENFNGNNNNFNNNFNHNNBFENKNNNNFGNCNNNNNFGFNFNENNFNNFNGNNNNFNHNNNEFNNNNNKFNNNGNNFNENNNNFGNCNNFNNNGNNFNENNNGNFNNFNNGFNKNNENFNNGNNNFNGFNNNNENFNNNNNCFNGFNNNNNNNEFBNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 736 152 20
Agility 683 102 20
Stamina 7631 6009 5861
Intellect 6097 5314 4926
Spirit 983 983 826
Health 143601 120963 0
Mana 113885 102860 0
Spell Power 10276 7511 2207
Spell Hit 17.03% 17.03% 919
Spell Crit 21.32% 15.11% 309
Spell Haste 19.90% 14.19% 1817
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 2436 466 0
Melee Hit 7.65% 7.65% 919
Melee Crit 14.75% 7.96% 309
Melee Haste 14.19% 14.19% 1817
Expertise 0.00 0.00 0
Armor 19472 15396 15396
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.92% 2.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 18.23% 18.23% 1834

Gear

Encoded
head headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
shirt empty
chest circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2 theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
tabard empty

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 3
Call of Flame 2
Elemental Warding 0
Reverberation 2
Elemental Precision 3
Rolling Thunder 2
Elemental Focus 1
Elemental Reach 2
Elemental Oath 2
Lava Flows 3
Fulmination 1
Elemental Mastery 1
Earth's Grasp 0
Totemic Wrath 1
Feedback 3
Lava Surge 2
Earthquake 1
Enhancement Rank
Elemental Weapons 2
Focused Strikes 0
Improved Shields 3
Elemental Devastation 0
Flurry 0
Ancestral Swiftness 2
Totemic Reach 2
Toughness 0
Stormstrike 0
Static Shock 0
Frozen Power 0
Seasoned Winds 0
Searing Flames 0
Earthen Power 0
Shamanistic Rage 0
Unleashed Rage 0
Maelstrom Weapon 0
Improved Lava Lash 0
Feral Spirit 0
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Elemental_T11_372
origin="http://chardev.org/?profile=14385"
level=85
race=troll
role=spell
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3032023212231101321203002200000000000000000000000000000000
glyphs=chain_lightning/thunder/healing_stream_totem/thunderstorm/astral_recall/renewed_life/flame_shock/lightning_bolt/lava_burst
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/flametongue_weapon,weapon=main
actions+=/lightning_shield
actions+=/mana_spring_totem
actions+=/wrath_of_air_totem
actions+=/snapshot_stats
actions+=/volcanic_potion,if=!in_combat|buff.bloodlust.react
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/berserking
actions+=/elemental_mastery
actions+=/unleash_elements,moving=1
actions+=/flame_shock,if=!ticking|ticks_remain<3
actions+=/lava_burst,if=(dot.flame_shock.remains-cast_time)>=0.05
actions+=/earth_shock,if=buff.lightning_shield.stack=9
actions+=/earth_shock,if=buff.lightning_shield.stack>6&dot.flame_shock.remains>cooldown&dot.flame_shock.remains actions+=/fire_elemental_totem
actions+=/earth_elemental_totem
actions+=/searing_totem
actions+=/spiritwalkers_grace,moving=1
actions+=/chain_lightning,if=target.adds>2
actions+=/lightning_bolt
actions+=/thunderstorm
head=headpiece_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2071armor_197haste_325int_257mastery_578sta,reforge=mastery_hit,gems=burning_shadowspirit_20haste_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta
shoulders=shoulderwraps_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1911armor_191crit_266int_171mastery_429sta,reforge=crit_hit,gems=20haste_20int_10int,enchant=50int_25haste
chest=circuit_design_breastplate,heroic=1,type=mail,ilevel=372,quality=epic,stats=2548armor_345int_257mastery_217spi_578sta,reforge=mastery_hit,gems=40int_40hit_20int,enchant=20all
waist=lightning_well_belt_of_the_feverflare,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266int_180haste_180mastery,gems=20hit_20int_40int_10int,suffix=230
legs=kilt_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=2230armor_257haste_345int_217spi_578sta,gems=20haste_20int_20hit_20int_20int,enchant=95int_55spi
feet=boots_of_azgalada,heroic=1,type=mail,ilevel=379,quality=epic,stats=1796armor_266int_194mastery_174spi_458sta,reforge=mastery_hit,gems=20haste_20int_40int_20int,enchant=50mastery
wrists=chaos_beast_bracers,heroic=1,type=mail,ilevel=372,quality=epic,stats=1115armor_215int_143mastery_143spi_322sta,reforge=mastery_hit,enchant=50int
hands=gloves_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=1593armor_191crit_171haste_266int_429sta,reforge=crit_hit,gems=20hit_20int_10int,enchant=65mastery
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_feverflare,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143haste_143mastery,reforge=mastery_hit,enchant=40int,suffix=138
trinket1=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
trinket2=theralions_mirror,heroic=1,ilevel=372,quality=epic,stats=363int,equip=onspellcast_2178mastery_10%_20dur_100cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,gems=20haste_20int_10int,enchant=30int
main_hand=incineratus,heroic=1,ilevel=372,quality=epic,stats=110haste_165int_110mastery_2207sp_248sta,reforge=mastery_hit,enchant=power_torrent,weapon=dagger_1.80speed_82min_154max
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=relic_of_norgannon,ilevel=359,quality=epic,stats=72crit_72haste_107int_161sta,reforge=crit_hit,gems=40int
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5861
# gear_intellect=4926
# gear_spirit=826
# gear_spell_power=2207
# gear_hit_rating=919
# gear_crit_rating=309
# gear_haste_rating=1817
# gear_mastery_rating=1834
# gear_armor=15396
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=incineratus,heroic=1,weapon=dagger_1.80speed_82min_154max,enchant=power_torrent

Shaman_Enh_T11_372 : 26228dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26227.8 10.64 / 0.04% 29.5 890.2 887.4 mana 5.35% 42.9
Origin http://chardev.org/?profile=39863
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:23737|18853|14819|9887|8528|3263|2947|1470|652&chds=0,47475&chco=C41F3B,C41F3B,336600,C79C6E,336600,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23737++lava_lash,C41F3B,0,0,15|t++18853++flame_shock,C41F3B,1,0,15|t++14819++lightning_bolt,336600,2,0,15|t++9887++stormstrike,C79C6E,3,0,15|t++8528++earth_shock,336600,4,0,15|t++3263++wolf_melee,C79C6E,5,0,15|t++2947++melee_main_hand,C79C6E,6,0,15|t++1470++melee_off_hand,C79C6E,7,0,15|t++652++earth_melee,C79C6E,8,0,15&chtt=Shaman_Enh_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x380&cht=p&chf=bg,s,333333&chd=t:13,11,11,10,10,8,6,5,4,4,4,3,3,3,2,2,2,1&chds=0,100&chco=C41F3B,C79C6E,336600,C79C6E,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,336600,336600,C79C6E,C41F3B,C41F3B,336600,C79C6E,C79C6E,C79C6E&chl=lava_lash|melee_main_hand|lightning_bolt|windfury_mh|searing_totem|flametongue_oh|melee_off_hand|flame_shock|stormstrike_mh|darkmoon_card_hurricane|earth_shock|wolf_melee|searing_flames|unleash_flame|lightning_shield|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777676654455444455556555556665566666666666665555666666665566555666666666665555555666666555555555666666666555555556666666665555666666666666655555566666665555565666666666665555555666666666666556666666666665555566666666655555566666666666655666666666666665555566666666665555555566666665555555666666666666666666666666665555566666666666555555556666666655555566666666666655555566666666655555666666665555555555556656555555556666666665555555555555666555555555&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=25120&chtt=Shaman_Enh_T11_372+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:y45554445557777655544522223210zyxwwvvvuuuuuttsrqppooonopppqqqqppooooooppqqqqqqqqpppppooppqqqqqqpppooooppqqqqqqpppppppppqqrsstttssstttttuuuvvvvvuuttttsssssssssrrqqppppppppoppppooooonnnnoooppppppoooooooopppppppooooooooooopppppoooonnnooopppqqqqqqqqqrrrsttuuutttttttttuuuuuuuuuttsssrrrrrrrrqqppooooooooooopppoooooooooooopppooooooooooopppppppoooooooooooooooooooooopppqqqrrrrrssssssssttttttttttttttttttttttsssrrrrqqpppppppoooonnnnoooooooppooooooooooooooooooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26228|max=36202&chxp=1,1,72,100&chtt=Shaman_Enh_T11_372+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,1,0,1,1,6,5,13,26,45,72,69,120,169,213,270,348,392,495,538,623,593,695,686,645,624,585,523,483,349,318,266,204,171,119,93,84,60,20,31,18,9,8,4,2,0,0,0,0,1&chds=0,695&chbh=5&chxt=x&chxl=0:|min=24149|avg=26228|max=28582&chxp=0,1,47,100&chtt=Shaman_Enh_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372 26228
darkmoon_card_hurricane 972 3.7% 38.4 12.03sec 11433 0 7954 16385 16385 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
38.44 38.44 0.00 0.00 0.0000 0.0000 439485
Direct Results Count Pct Average Min Max Total Damage
hit 22.6 58.74% 7953.66 7954 7954 179589
crit 15.9 41.26% 16384.54 16385 16385 259896

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 925 3.5% 36.7 12.18sec 11408 8528 8813 13615 17108 54.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.65 36.65 0.00 0.00 1.3378 0.0000 418165
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 45.69% 8812.56 8337 11073 147589
crit 19.9 54.22% 13614.63 12880 17108 270576
miss 0.0 0.09% 0.00 0 0 0

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
fire_nova 0 0.0% 56.6 7.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
56.64 0.00 0.00 0.00 1.3348 0.0000 0

Action details: fire_nova

Static Values
  • id:1535
  • school:fire
  • resource:mana
  • tree:elemental
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5154.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites your Flame Shock spell on any nearby enemies, causing each of them to emit a wave of flames that deals $8349s2 Fire damage to every other enemy within $8349A2 yards.
flame_shock 1290 4.9% 23.1 19.82sec 25240 18853 5868 9060 12271 19.3% 0.1% 0.0% 0.0% 155 2529 3905 19.3% 0.0% 90.7%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.11 23.11 155.15 155.15 1.3388 2.6429 583317
Direct Results Count Pct Average Min Max Total Damage
hit 18.6 80.66% 5868.00 4647 7942 109379
crit 4.4 19.25% 9059.55 7180 12271 40305
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.2 80.67% 2528.71 1992 3481 316497
crit 30.0 19.33% 3905.46 3078 5377 117136

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 2198 8.4% 339.4 1.33sec 2928 0 2652 4096 5174 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
339.40 339.40 0.00 0.00 0.0000 0.0000 993815
Direct Results Count Pct Average Min Max Total Damage
hit 273.5 80.59% 2651.56 2495 3349 725283
crit 65.6 19.32% 4095.88 3855 5174 268532
miss 0.3 0.09% 0.00 0 0 0

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_lash 3379 12.9% 42.6 10.72sec 35874 23737 24985 51579 63098 41.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
42.58 42.58 0.00 0.00 1.5113 0.0000 1527409
Direct Results Count Pct Average Min Max Total Damage
hit 25.1 58.88% 24984.68 18292 30630 626378
crit 17.5 41.03% 51579.10 37682 63098 901030
dodge 0.0 0.09% 0.00 0 0 0

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 2843 10.8% 65.0 6.92sec 19776 14819 14701 22664 29138 64.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
64.99 64.97 0.00 0.00 1.3345 0.0000 1285248
Direct Results Count Pct Average Min Max Total Damage
hit 23.3 35.92% 14700.68 13799 18860 343059
crit 41.6 63.99% 22664.40 21319 29138 942188
miss 0.1 0.09% 0.00 0 0 0

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 620 2.4% 40.8 11.13sec 6876 0 5463 8420 10738 52.5% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.77 40.77 0.00 0.00 0.0000 0.0000 280323
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 44.99% 5463.04 5130 6950 100194
crit 21.4 52.48% 8420.01 7926 10738 180128
miss 0.0 0.08% 0.00 0 0 0
none 1.0 2.45% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2910 11.1% 287.0 1.58sec 4584 2947 3498 7212 8743 41.3% 6.9% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
287.03 287.03 0.00 0.00 1.5554 0.0000 1315707
Direct Results Count Pct Average Min Max Total Damage
hit 79.8 27.81% 3498.13 3338 4244 279254
crit 118.7 41.34% 7211.52 6876 8743 855666
glance 68.9 23.99% 2625.02 2503 3183 180787
dodge 0.3 0.09% 0.00 0 0 0
miss 19.4 6.77% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1452 5.5% 286.4 1.58sec 2292 1470 1749 3606 4371 41.3% 6.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
286.35 286.35 0.00 0.00 1.5588 0.0000 656273
Direct Results Count Pct Average Min Max Total Damage
hit 79.7 27.85% 1749.06 1669 2122 139482
crit 118.3 41.30% 3605.62 3438 4371 426425
glance 68.9 24.05% 1312.29 1252 1592 90366
dodge 0.2 0.09% 0.00 0 0 0
miss 19.2 6.72% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 792 3.0% 279.0 1.62sec 1284 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121 2743 4240 14.3% 0.0% 80.4%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
278.95 278.95 121.09 121.09 0.0000 3.0000 358046
Direct Results Count Pct Average Min Max Total Damage
hit 279.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 103.8 85.71% 2743.05 716 4945 284681
crit 17.3 14.29% 4239.53 1106 7640 73365

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:755.38
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 2598 9.9% 8.1 59.88sec 145611 143831 0 0 0 0.0% 0.0% 0.0% 0.0% 279 3809 5887 19.3% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.07 8.07 279.22 278.95 1.0124 1.6000 1174662
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 225.0 80.67% 3809.49 3578 4944 857311
crit 53.9 19.33% 5886.85 5528 7639 317351

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 123.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.16 4.16 0.00 0.00 1.2909 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1524 5.8% 46.2 9.79sec 14916 9887 0 0 0 0.0% 0.8% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.19 46.19 0.00 0.00 1.5087 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 45.8 99.17% 0.00 0 0 0
dodge 0.4 0.83% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 1015 3.9% 45.8 9.87sec 10019 0 6971 14370 17431 41.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.80 45.80 0.00 0.00 0.0000 0.0000 458918
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 58.80% 6971.29 6655 8462 187755
crit 18.9 41.20% 14369.68 13709 17431 271163

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 509 1.9% 45.8 9.87sec 5022 0 3492 7196 8716 41.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.80 45.80 0.00 0.00 0.0000 0.0000 230031
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 58.69% 3491.67 3327 4231 93855
crit 18.9 41.31% 7196.13 6855 8716 136176

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.5 16.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 1.3330 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 664 2.5% 28.5 16.08sec 10548 0 9551 14756 18383 19.3% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 0.0000 0.0000 300328
Direct Results Count Pct Average Min Max Total Damage
hit 22.9 80.58% 9550.87 9046 11899 219127
crit 5.5 19.33% 14755.86 13975 18383 81201
miss 0.0 0.09% 0.00 0 0 0

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 395 1.5% 28.5 16.08sec 6276 0 4374 9006 10828 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 0.0000 0.0000 178686
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 58.74% 4373.52 4172 5256 73123
crit 11.7 41.18% 9006.45 8595 10828 105564
dodge 0.0 0.09% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 2627 10.0% 140.9 9.53sec 8428 0 5867 12091 14231 41.2% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
140.94 140.94 0.00 0.00 0.0000 0.0000 1187827
Direct Results Count Pct Average Min Max Total Damage
hit 82.7 58.69% 5866.70 5640 6908 485233
crit 58.1 41.23% 12090.87 11617 14231 702593
dodge 0.1 0.08% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 936
wolf_melee 936 100.0% 89.1 4.68sec 4402 3263 4672 9339 10970 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.10 89.10 0.00 0.00 1.3490 0.0000 392215
Direct Results Count Pct Average Min Max Total Damage
hit 67.5 75.81% 4672.41 4448 5485 315599
crit 0.2 0.21% 9339.32 8897 10970 1777
glance 21.4 23.97% 3503.76 3336 4114 74839

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 600
earth_melee 600 100.0% 59.0 2.00sec 1305 652 1346 2692 2815 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 76984
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 73.04% 1345.97 1315 1407 58005
crit 1.8 2.97% 2691.71 2629 2815 4713
glance 14.1 23.95% 1009.42 986 1056 14266
dodge 0.0 0.04% 0.00 0 0 0

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 9.6% 10.8 1054
fire_nova mana 18.1% 0.0 1288
flame_shock mana 5.7% 25.3 996
flametongue_oh mana 29.6% 8.3 351
lava_lash mana 9.9% 38.3 937
lightning_bolt mana 0.9% 338.5 58
searing_totem mana 0.6% 497.4 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 21.5% 8.0 1874
unleash_elements mana 2.9% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 23489.0 13.0 20.3%
initial_mana none 1.0 25595.0 25595.0 0.0%
mp5_regen mana 1808.8 85705.0 47.4 19.1%
primal_wisdom mana 323.6 282707.4 873.5 25.4%
replenishment mana 1808.8 9267.1 5.1 19.9%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 9.8 77.5 46.0sec 5.1sec 91% 90%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 920.9 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 72.9 289.1 6.2sec 1.2sec 86% 85%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 11.9 7.9 37.4sec 21.9sec 41% 43%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 10.4 5.0 42.2sec 27.8sec 34% 35%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 65.8 285.0 6.9sec 1.3sec 80% 89%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.6 44.2 207.7sec 9.9sec 98% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 339.2sec 339.2sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.5 0.0 16.1sec 16.1sec 20% 34%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.5 0.0 16.1sec 16.1sec 21% 29%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 5%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 38.4 12.0sec
flametongue_icd 15.8 27.0sec
maelstrom_weapon 350.8 1.5sec
static_shock 39.8 11.3sec
swings_clipped_mh 3.1 95.0sec
swings_clipped_oh 3.1 94.7sec
wasted_maelstrom_weapon 37.1 13.5sec
windfury 47.0 9.5sec

Statistics & Data Analysis

DPS
Population
Convergence 71.10%
σ of the average dps 5.3183
2 * σ / μ 0.0406%
95% Confidence Intervall ( μ ± 2σ ) ( 26217.17 - 26238.44 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26211.85 - 26243.76 )
Sample Data
σ 531.8309
Minimum 24148.57
Maximum 28581.85
Spread ( max - min ) 4433.28
Range ( max - min ) / 2 2216.64
Range% 8.45
10th Percentile 25563.52
90th Percentile 26925.21
( 90th Percentile - 10th Percentile ) 1361.69
Approx. Iterations needed for
1% dps error 16
0.1% dps error 1644
0.1 scale factor error with delta=300 2514
0.05 scale factor error with delta=300 10056
0.01 scale factor error with delta=300 251416
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react

Sample Sequence

012378AEFGIJHLMNOKGHLHKOIQGJLOHKOGHIKLHOQGJLOHIKOGHLKOFQGIHJLOQGKOHLHIJGHLOKQOGKHILOHJGOLHKOIGLHEFJOQLGHIKMLOGKOLQIGJOHLOKHGOHIJLHOGKOLHOIJFGHHKLHOHGIJHLHOKGOLKHIOGKHLQJOGHIKLOHGKOLEFHIJGLHOKMOLGIHJOLQOGKOLHIKOGLQJOLGHIKOLQFGJOLHIKGHLOKQOGHIJHLOHGHKLOIHJGLOQKOQGIKLEFHOJGHLOIKHMGHKLHJGHILHKOGQLKHOIGJHLOQKOGFHIJLHOGKHLOKHGIHJLOGKHLOIHJGLHOKOLGHIJOFHELGKHOLIJGHMLKOQGOIHJLHOGKOLQIKOGLHKLGFHIJ

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7775 5075 4756
Stamina 7541 5924 5775
Intellect 163 156 20
Spirit 178 178 20
Health 142355 119773 0
Mana 25595 25490 0
Spell Power 11357 5448 0
Spell Hit 16.91% 16.91% 1712
Spell Crit 16.13% 11.12% 1018
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 18248 10603 190
Melee Hit 20.25% 20.25% 1712
Melee Crit 40.53% 27.22% 1018
Melee Haste 5.13% 5.13% 657
Expertise 22.65 22.65 440
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 24.24% 16.86% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.20% 17.20% 1650

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Seasoned Winds 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372
origin="http://chardev.org/?profile=39863"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3022003000000000000230332001302301232100000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=4&buff.maelstrom_weapon.react
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_hit,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_hit,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4756
# gear_stamina=5775
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=440
# gear_hit_rating=1712
# gear_crit_rating=1018
# gear_haste_rating=657
# gear_mastery_rating=1650
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Shaman_Enh_T11_372_Caster : 25947dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
25947.0 8.85 / 0.03% 27.4 947.9 944.2 mana 0.82% 44.2
Origin http://chardev.org/?profile=39882
Talents http://www.wowhead.com/talent#shaman-302200300000000000023033200130230123210000000000000000000
Glyphs
  • ghost_wolf
  • lightning_shield
  • chain_lightning
  • astral_recall
  • renewed_life
  • water_walking
  • feral_spirit
  • lava_lash
  • stormstrike

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:23474|22402|17760|15811|10125|7022|3210|2385|1411|741&chds=0,46948&chco=C41F3B,C41F3B,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++23474++lava_lash,C41F3B,0,0,15|t++22402++flame_shock,C41F3B,1,0,15|t++17760++lightning_bolt,336600,2,0,15|t++15811++lava_burst,C41F3B,3,0,15|t++10125++earth_shock,336600,4,0,15|t++7022++stormstrike,C79C6E,5,0,15|t++3210++wolf_melee,C79C6E,6,0,15|t++2385++melee_main_hand,C79C6E,7,0,15|t++1411++melee_off_hand,C79C6E,8,0,15|t++741++earth_melee,C79C6E,9,0,15&chtt=Shaman_Enh_T11_372_Caster+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x390&cht=p&chf=bg,s,333333&chd=t:13,13,12,8,7,7,6,5,4,4,3,3,3,3,3,2,2,1,1&chds=0,100&chco=336600,C41F3B,C41F3B,C79C6E,C41F3B,C79C6E,C41F3B,C79C6E,336600,C41F3B,C41F3B,C79C6E,336600,C41F3B,336600,C79C6E,C79C6E,C79C6E,C79C6E&chl=lightning_bolt|lava_lash|searing_totem|melee_main_hand|flametongue_oh|windfury_mh|flame_shock|melee_off_hand|earth_shock|searing_flames|lava_burst|wolf_melee|darkmoon_card_hurricane|unleash_flame|lightning_shield|stormstrike_mh|stormstrike_oh|unleash_wind|earth_melee&chtt=Shaman_Enh_T11_372_Caster+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7877777655566565566555555556421123445555444444444555555555566665566666666654444445555555555555543334455555543333344555566665555555666666666554444555556555555555444455555555443334555566666555555555555555555544444455555544444455444455555555444455556666655555666666655555555444445555555544444455555555555555555555555555544444455555555555554444445555555444444455555555555555555555666655555555555555555555555444555555544444455555555555555554444555555544444&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=27780&chtt=Shaman_Enh_T11_372_Caster+Mana+Timeline&chts=dddddd,18&chco=2459FF http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:x445544444477776555665333343200zyxxwwvvwuuuttsrqqpppooopppqqqqpoooopoppqqrqqpqqqqqqqqppppqqrrqqqpppppppqqrrrqppqqqqqqqqpqrsttttttstttuuuvvvvvvuuuutttttttsssssrrrqqppoppppppppoooooooooooooooppppooooooopppppppooooooooopppppppppoooonnnooppqqppppqqrrrssttttuuuuuuuuuttuuuuuuutttsssssrrrrrqqqqppooooooooooppooooonoooopppppppppppooooooopppppppooooooooppppoooooooooppppqqrrrrrsssssstttuuuuuuuuuttuutttttttttssrrrqqqpppppppooooooooooooooopppoooooooooooppppoooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=25947|max=35671&chxp=1,1,73,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,1,4,2,5,9,15,26,35,45,73,85,131,150,220,261,302,379,464,440,523,582,639,590,603,495,593,513,466,433,362,323,251,233,180,146,102,99,77,43,35,20,15,17,4,4,3,0,0,1&chds=0,639&chbh=5&chxt=x&chxl=0:|min=24348|avg=25947|max=27671&chxp=0,1,48,100&chtt=Shaman_Enh_T11_372_Caster+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Shaman_Enh_T11_372_Caster 25947
darkmoon_card_hurricane 826 3.2% 32.5 14.08sec 11486 0 8040 16562 16562 40.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_hurricane

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.51 32.51 0.00 0.00 0.0000 0.0000 373419
Direct Results Count Pct Average Min Max Total Damage
hit 19.4 59.56% 8039.87 8040 8040 155688
crit 13.1 40.44% 16562.13 16562 16562 217731

Action details: darkmoon_card_hurricane

Static Values
  • id:0
  • school:nature
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:5000.00
  • base_dd_max:5000.00
earth_shock 1039 4.0% 34.7 12.88sec 13543 10125 10465 16165 19757 54.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.69 34.69 0.00 0.00 1.3376 0.0000 469763
Direct Results Count Pct Average Min Max Total Damage
hit 16.0 46.01% 10465.11 10022 12787 167004
crit 18.7 53.99% 16164.89 15483 19757 302759

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:4217.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Time between attacks increased by $s1%.
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and reducing melee and ranged attack speed by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.386000
  • base_dd_min:906.48
  • base_dd_max:955.84
fire_nova 0 0.0% 56.0 7.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_nova

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.98 0.00 0.00 0.00 1.3389 0.0000 0

Action details: fire_nova

Static Values
  • id:1535
  • school:fire
  • resource:mana
  • tree:elemental
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5154.0
  • cooldown:4.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites your Flame Shock spell on any nearby enemies, causing each of them to emit a wave of flames that deals $8349s2 Fire damage to every other enemy within $8349A2 yards.
flame_shock 1580 6.1% 23.7 19.32sec 30127 22402 7056 10897 14164 19.0% 0.0% 0.0% 0.0% 156 3072 4746 18.9% 0.0% 91.9%

Stats details: flame_shock

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
23.71 23.71 156.31 156.31 1.3448 2.6569 714339
Direct Results Count Pct Average Min Max Total Damage
hit 19.2 81.04% 7055.81 5582 9167 135582
crit 4.5 18.96% 10897.11 8624 14164 48989
Tick Results Count Pct Average Min Max Total Damage
hit 126.7 81.06% 3072.13 2427 4050 389239
crit 29.6 18.94% 4746.01 3750 6258 140529

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • tree:elemental
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3983.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.214000
  • base_dd_min:531.37
  • base_dd_max:531.37
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.100000
  • base_td:142.64
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 1944 7.5% 304.5 1.48sec 2887 0 2616 4042 5146 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
304.47 304.47 0.00 0.00 0.0000 0.0000 879068
Direct Results Count Pct Average Min Max Total Damage
hit 246.6 80.98% 2616.17 2468 3331 645074
crit 57.9 19.02% 4041.55 3813 5146 233994

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing total spell damage by $10400s2$?s55451[ and increasing spell critical strike chance by $55451s1%.][.] Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 30 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:198.75
  • base_dd_max:198.75
lava_burst 887 3.4% 14.0 30.93sec 28673 15811 0 28683 41647 100.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.99 13.98 0.00 0.00 1.8134 0.0000 401017
Direct Results Count Pct Average Min Max Total Damage
crit 14.0 100.00% 28683.19 27821 41647 401017

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:2343.0
  • cooldown:8.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1394.17
  • base_dd_max:1778.00
lava_lash 3273 12.6% 41.8 10.92sec 35369 23474 24760 51104 62931 40.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
41.83 41.83 0.00 0.00 1.5067 0.0000 1479543
Direct Results Count Pct Average Min Max Total Damage
hit 25.0 59.73% 24759.53 18215 30549 618614
crit 16.8 40.27% 51103.73 37523 62931 860929

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:937.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.00
lightning_bolt 3418 13.2% 64.8 6.93sec 23834 17760 17726 27343 34011 63.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
64.84 64.82 0.00 0.00 1.3420 0.0000 1545436
Direct Results Count Pct Average Min Max Total Damage
hit 23.6 36.41% 17725.85 16897 22013 418321
crit 41.2 63.59% 27343.48 26106 34011 1127115

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • tree:elemental
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1405.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.714000
  • base_dd_min:719.21
  • base_dd_max:821.68
lightning_shield 732 2.8% 40.1 11.33sec 8258 0 6564 10123 12493 52.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
40.09 40.09 0.00 0.00 0.0000 0.0000 331085
Direct Results Count Pct Average Min Max Total Damage
hit 18.2 45.31% 6564.09 6246 8086 119241
crit 20.9 52.20% 10123.32 9651 12493 211845
none 1.0 2.49% 0.00 0 0 0

Action details: lightning_shield

Static Values
  • id:26364
  • school:nature
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.267000
  • base_dd_min:390.75
  • base_dd_max:390.75
melee_main_hand 2085 8.0% 361.1 1.25sec 2611 2385 2018 4160 5234 40.5% 7.6% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
361.08 361.08 0.00 0.00 1.0946 0.0000 942755
Direct Results Count Pct Average Min Max Total Damage
hit 101.0 27.97% 2017.81 1913 2541 203814
crit 146.1 40.46% 4159.97 3942 5234 607726
glance 86.7 24.00% 1513.99 1435 1906 131215
dodge 1.8 0.49% 0.00 0 0 0
miss 25.5 7.07% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 1224 4.7% 248.4 1.82sec 2227 1411 1716 3537 4313 40.4% 7.1% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
248.42 248.42 0.00 0.00 1.5783 0.0000 553321
Direct Results Count Pct Average Min Max Total Damage
hit 70.8 28.50% 1715.80 1641 2094 121461
crit 100.4 40.42% 3536.62 3380 4313 355124
glance 59.6 24.00% 1287.20 1230 1570 76736
miss 17.6 7.08% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_flames 967 3.7% 279.2 1.62sec 1566 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121 3356 5174 14.0% 0.0% 80.4%

Stats details: searing_flames

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
279.18 279.18 121.09 121.09 0.0000 3.0000 437147
Direct Results Count Pct Average Min Max Total Damage
hit 279.2 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 104.2 86.01% 3355.73 883 5795 349523
crit 16.9 13.99% 5174.07 1364 8953 87623

Action details: searing_flames

Static Values
  • id:77661
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:200.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Deals $s1 Fire damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:882.58
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
searing_totem 3154 12.2% 8.1 59.89sec 176805 174811 0 0 0 0.0% 0.0% 0.0% 0.0% 279 4628 7151 19.0% 0.0% 98.8%

Stats details: searing_totem

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
8.06 8.06 279.18 279.18 1.0114 1.6000 1425934
Direct Results Count Pct Average Min Max Total Damage
hit 8.1 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 226.1 81.00% 4628.21 4413 5794 1046557
crit 53.1 19.00% 7150.82 6818 8951 379377

Action details: searing_totem

Static Values
  • id:3599
  • school:fire
  • resource:mana
  • tree:elemental
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:1171.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a Searing Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage. The totem will prefer to target enemies that are afflicted by your Flame Shock or Stormstrike effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.167000
  • base_dd_min:92.00
  • base_dd_max:120.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:37
  • base_tick_time:1.60
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
spirit_wolf 0 0.0% 4.2 122.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_wolf

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.18 4.18 0.00 0.00 1.2954 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.2 100.00% 0.00 0 0 0

Action details: spirit_wolf

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • tree:enhancement
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2811.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Shaman, lasting $d.
stormstrike 1054 4.1% 45.1 10.03sec 10575 7022 0 0 0 0.0% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.05 45.05 0.00 0.00 1.5061 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 44.8 99.50% 0.00 0 0 0
dodge 0.2 0.50% 0.00 0 0 0

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1874.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
stormstrike_mh 569 2.2% 44.8 10.08sec 5741 0 4018 8281 10435 40.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.83 44.83 0.00 0.00 0.0000 0.0000 257355
Direct Results Count Pct Average Min Max Total Damage
hit 26.7 59.59% 4018.33 3815 5066 107353
crit 18.1 40.41% 8281.40 7859 10435 150003

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
stormstrike_oh 485 1.9% 44.8 10.08sec 4888 0 3423 7052 8599 40.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.83 44.83 0.00 0.00 0.0000 0.0000 219116
Direct Results Count Pct Average Min Max Total Damage
hit 26.7 59.62% 3422.51 3271 4174 91478
crit 18.1 40.38% 7051.61 6738 8599 127638

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and increasing any Nature damage you deal to that target by $17364s1% for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.81
unleash_elements 0 0.0% 28.5 16.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 1.3384 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 28.5 100.00% 0.00 0 0 0

Action details: unleash_elements

Static Values
  • id:73680
  • school:physical
  • resource:mana
  • tree:enhancement
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1640.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 786 3.0% 28.5 16.08sec 12489 0 11315 17488 21326 19.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.47 0.00 0.00 0.0000 0.0000 355539
Direct Results Count Pct Average Min Max Total Damage
hit 23.1 80.98% 11314.94 10847 13803 260849
crit 5.4 19.02% 17487.56 16759 21326 94690

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1022.97
  • base_dd_max:1213.02
unleash_wind 225 0.9% 28.5 16.08sec 3581 0 2517 5186 6543 40.4% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
28.47 28.46 0.00 0.00 0.0000 0.0000 101945
Direct Results Count Pct Average Min Max Total Damage
hit 16.8 59.12% 2517.13 2392 3176 42353
crit 11.5 40.38% 5185.85 4927 6543 59592
dodge 0.1 0.50% 0.00 0 0 0

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
windfury_mh 1698 6.5% 154.6 8.72sec 4968 0 3493 7199 8706 40.3% 0.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
154.57 154.57 0.00 0.00 0.0000 0.0000 767866
Direct Results Count Pct Average Min Max Total Damage
hit 91.6 59.24% 3492.81 3348 4226 319838
crit 62.2 40.26% 7198.74 6897 8706 448028
dodge 0.8 0.50% 0.00 0 0 0

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 925
wolf_melee 925 100.0% 89.6 4.67sec 4333 3210 4600 9209 10840 0.2% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: wolf_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
89.60 89.60 0.00 0.00 1.3497 0.0000 388235
Direct Results Count Pct Average Min Max Total Damage
hit 67.9 75.83% 4599.77 4384 5420 312526
crit 0.2 0.20% 9208.59 8767 10840 1611
glance 21.5 23.97% 3449.48 3288 4065 74099

Action details: wolf_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - earth_elemental 682
earth_melee 682 100.0% 59.0 2.00sec 1482 741 1528 3056 3182 3.0% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
59.00 59.00 0.00 0.00 2.0000 0.0000 87454
Direct Results Count Pct Average Min Max Total Damage
hit 43.1 73.02% 1528.13 1498 1591 65837
crit 1.8 2.99% 3056.49 2997 3182 5397
glance 14.2 23.98% 1146.17 1124 1193 16219

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.049237
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Shaman_Enh_T11_372_Caster
bloodlust mana 0.0% 0.0 1523
earth_elemental_totem mana 0.3% 0.0 1406
earth_shock mana 8.5% 12.8 1054
fire_nova mana 16.8% 0.0 1288
flame_shock mana 5.5% 30.3 996
flametongue_oh mana 25.0% 8.2 351
lava_burst mana 7.6% 12.2 2343
lava_lash mana 9.1% 37.7 937
lightning_bolt mana 3.4% 106.5 224
searing_totem mana 0.6% 603.9 293
spirit_wolf mana 0.7% 0.0 703
stormstrike mana 19.7% 5.6 1874
unleash_elements mana 2.7% 0.0 410
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 23718.5 13.1 19.6%
initial_mana none 1.0 28205.0 28205.0 0.0%
mp5_regen mana 1808.8 86333.8 47.7 18.5%
primal_wisdom mana 340.1 306530.5 901.3 23.1%
replenishment mana 1808.8 10284.1 5.7 19.4%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury_ap 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_ap
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
blood_fury_sp 4.3 0.0 120.6sec 120.6sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
elemental_devastation 7.8 91.6 57.9sec 4.5sec 94% 94%

Database details

  • id:29180
  • cooldown name:buff_elemental_devastation
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
fluid_death 1.0 954.5 0.0sec 0.5sec 100% 100%

Database details

  • id:
  • cooldown name:buff_fluid_death
  • tooltip:(null)
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 79.5 293.8 5.7sec 1.2sec 84% 84%

Database details

  • id:16278
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 10.6 5.4 41.5sec 26.8sec 34% 36%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.7 4.0 44.6sec 30.7sec 31% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
maelstrom_weapon 65.6 231.9 6.9sec 1.5sec 77% 83%

Database details

  • id:53817
  • cooldown name:buff_maelstrom_weapon
  • tooltip:Reduces the cast time and mana cost of your next Lightning Bolt, Chain Lightning, Hex, or any healing spell by $s1%.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
stormstrike 1.5 43.4 224.5sec 10.1sec 99% 98%

Database details

  • id:17364
  • cooldown name:buff_stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
tolvir_potion 1.0 0.0 338.9sec 338.9sec 4% 4%

Database details

  • id:
  • cooldown name:buff_tolvir_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
unleash_flame 28.5 0.0 16.1sec 16.1sec 17% 29%

Database details

  • id:73683
  • cooldown name:buff_unleash_flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
unleash_wind 28.5 0.0 16.1sec 16.1sec 17% 26%

Database details

  • id:73681
  • cooldown name:buff_unleash_wind
  • tooltip:Melee attack speed increased by $w2%.
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
spirit_wolf-bloodlust 0.3 0.0 0.0sec 0.0sec 1% 4%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_shield

Database details

  • id:324
  • cooldown name:buff_lightning_shield
  • tooltip:Deals Nature damage to attackers.
  • max_stacks:3
  • duration:600.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval
darkmoon_card_hurricane 32.5 14.1sec
flametongue_icd 13.0 32.6sec
maelstrom_weapon 297.5 1.7sec
static_shock 39.1 11.5sec
swings_clipped_mh 18.1 23.8sec
swings_clipped_oh 12.5 33.6sec
wasted_maelstrom_weapon 22.9 20.3sec
windfury 51.5 8.7sec

Statistics & Data Analysis

DPS
Population
Convergence 70.68%
σ of the average dps 4.4269
2 * σ / μ 0.0341%
95% Confidence Intervall ( μ ± 2σ ) ( 25938.13 - 25955.84 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 25933.70 - 25960.26 )
Sample Data
σ 442.6852
Minimum 24348.41
Maximum 27671.27
Spread ( max - min ) 3322.86
Range ( max - min ) / 2 1661.43
Range% 6.40
10th Percentile 25399.69
90th Percentile 26536.37
( 90th Percentile - 10th Percentile ) 1136.68
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1164
0.1 scale factor error with delta=300 1741
0.05 scale factor error with delta=300 6967
0.01 scale factor error with delta=300 174195
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=winds
1 food,type=seafood_magnifique_feast
2 windfury_weapon,weapon=main
3 flametongue_weapon,weapon=off
4 strength_of_earth_totem
5 windfury_totem
6 mana_spring_totem
7 lightning_shield
8 tolvir_potion,if=!in_combat|buff.bloodlust.react
9 snapshot_stats
A auto_attack
B wind_shear
C bloodlust,health_percentage<=25
D bloodlust,if=target.time_to_die<=60
E blood_fury
F searing_totem
G lava_lash
H lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
I unleash_elements
J flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
K earth_shock
L stormstrike
M spirit_wolf
N earth_elemental_totem
O fire_nova
P spiritwalkers_grace,moving=1
Q lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
R lava_burst,if=dot.flame_shock.remains>cast_time+0.5

Sample Sequence

012378AEFGIJLMNHOKGHLOKIQOQGJLHOQRKOGILHKOQGJLOQIKOGLOKFHOLGIHJOLQOGKOHILHJGOQLKOQIGHKLOQJGOLIKHOFEGKLOQMIJGHLOKQORGIJLHOQKGLOQIJOHGLKHORKGIFLHJOQGLHKIOQLGHKLQIGJOLHOKRGHIJLHORGKLHFIEJOGLOKMHOLGHIJOLQOGKOLQIJOGLHKOQRGIJLHOQKFGHLIKOHGLJHORKGILOKHOQGJLOIQKOGHLKOQIGJLFOHEKOGLIHJMOLGHKOQILJGOQRKLOGIHJLOHRGKLOHIFJGLOQKORGIHJLOQRGKLOIHKOGLHJOQRGIKLHORGKFLQIEJOGLHKOMQLGHIJOLQOGKOLHIJOGHLKOQRGIJLHFOKGHL

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 738 154 20
Agility 7593 4901 4591
Stamina 7540 5923 5774
Intellect 337 321 185
Spirit 244 244 86
Health 142341 119759 0
Mana 28205 27965 0
Spell Power 13755 7646 2207
Spell Hit 17.15% 17.15% 1671
Spell Crit 15.79% 10.76% 908
Spell Haste 9.85% 4.62% 591
Spell Penetration 0 0 0
Mana Per 5 1171 1171 0
Attack Power 17848 10257 190
Melee Hit 19.91% 19.91% 1671
Melee Crit 39.36% 26.07% 908
Melee Haste 4.62% 4.62% 591
Expertise 24.02 24.02 481
Armor 19458 15382 15382
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 23.79% 16.40% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 17.82% 17.82% 1760

Gear

Encoded
head helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
shirt empty
chest cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1 mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2 lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1 darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2 fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard gnomeregan_tabard,ilevel=1

Talents

Elemental Rank
Acuity 3
Convection 0
Concussion 2
Call of Flame 2
Elemental Warding 0
Reverberation 0
Elemental Precision 3
Rolling Thunder 0
Elemental Focus 0
Elemental Reach 0
Elemental Oath 0
Lava Flows 0
Fulmination 0
Elemental Mastery 0
Earth's Grasp 0
Totemic Wrath 0
Feedback 0
Lava Surge 0
Earthquake 0
Enhancement Rank
Elemental Weapons 2
Focused Strikes 3
Improved Shields 0
Elemental Devastation 3
Flurry 3
Ancestral Swiftness 2
Totemic Reach 0
Toughness 0
Stormstrike 1
Static Shock 3
Frozen Power 0
Seasoned Winds 2
Searing Flames 3
Earthen Power 0
Shamanistic Rage 1
Unleashed Rage 2
Maelstrom Weapon 3
Improved Lava Lash 2
Feral Spirit 1
Restoration Rank
Ancestral Resolve 0
Tidal Focus 0
Spark of Life 0
Improved Water Shield 0
Totemic Focus 0
Focused Insight 0
Nature's Guardian 0
Ancestral Healing 0
Nature's Swiftness 0
Nature's Blessing 0
Soothing Rains 0
Improved Cleanse Spirit 0
Cleansing Waters 0
Ancestral Awakening 0
Mana Tide Totem 0
Telluric Currents 0
Spirit Link Totem 0
Tidal Waves 0
Blessing of the Eternals 0
Riptide 0

Profile

#!./simc

shaman=Shaman_Enh_T11_372_Caster
origin="http://chardev.org/?profile=39882"
level=85
race=orc
role=hybrid
use_pre_potion=1
professions=alchemy=525/enchanting=525
talents=http://www.wowhead.com/talent#shaman-3022003000000000000230332001302301232100000000000000000000
glyphs=ghost_wolf/lightning_shield/chain_lightning/astral_recall/renewed_life/water_walking/feral_spirit/lava_lash/stormstrike
actions=flask,type=winds
actions+=/food,type=seafood_magnifique_feast
actions+=/windfury_weapon,weapon=main
actions+=/flametongue_weapon,weapon=off
actions+=/strength_of_earth_totem
actions+=/windfury_totem
actions+=/mana_spring_totem
actions+=/lightning_shield
actions+=/tolvir_potion,if=!in_combat|buff.bloodlust.react
actions+=/snapshot_stats
actions+=/auto_attack
actions+=/wind_shear
actions+=/bloodlust,health_percentage<=25
actions+=/bloodlust,if=target.time_to_die<=60
actions+=/blood_fury
actions+=/searing_totem
actions+=/lava_lash
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack=5&buff.maelstrom_weapon.react
actions+=/unleash_elements
actions+=/flame_shock,if=!ticking|(buff.unleash_flame.up&ticks_remain<=2)
actions+=/earth_shock
actions+=/stormstrike
actions+=/spirit_wolf
actions+=/earth_elemental_totem
actions+=/fire_nova
actions+=/spiritwalkers_grace,moving=1
actions+=/lightning_bolt,if=buff.maelstrom_weapon.stack>1&buff.maelstrom_weapon.react
actions+=/lava_burst,if=dot.flame_shock.remains>cast_time+0.5
head=helmet_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=325agi_2071armor_257hit_197mastery_578sta,gems=agile_shadowspirit_20agi_20mastery_30agi,enchant=60agi_35haste
neck=necklace_of_strife,heroic=1,ilevel=372,quality=epic,stats=215agi_143haste_143mastery_322sta,reforge=haste_exp
shoulders=spaulders_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1911armor_171hit_191mastery_429sta,gems=40agi_10mastery,enchant=50agi_25mastery
chest=cuirass_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=345agi_2548armor_217haste_257mastery_578sta,reforge=haste_exp,gems=40agi_20agi_20hit_20agi,enchant=20all
waist=star_chaser_belt_of_the_windstorm,heroic=1,type=mail,ilevel=372,quality=epic,stats=1433armor_429sta_266agi_180crit_180mastery,reforge=crit_hit,gems=40agi_40agi,suffix=235
legs=twilight_scale_leggings,heroic=1,type=mail,ilevel=379,quality=epic,stats=351agi_2286armor_254crit_234mastery_617sta,reforge=crit_hit,gems=40agi_40agi_40agi,enchant=190ap_55crit
feet=boots_of_vertigo,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1752armor_191haste_171hit_429sta,reforge=haste_exp,gems=40agi,enchant=35agi
wrists=chimaeron_armguards,heroic=1,type=mail,ilevel=372,quality=epic,stats=215agi_1115armor_143crit_143hit_322sta,reforge=crit_exp,enchant=50agi
hands=grips_of_the_raging_elements,heroic=1,type=mail,ilevel=372,quality=epic,stats=266agi_1593armor_191crit_171hit_429sta,reforge=crit_exp,gems=40agi,enchant=50mastery
finger1=mistral_circle_of_the_zephyr,heroic=1,ilevel=372,quality=epic,stats=321sta_214agi_143haste_143mastery,reforge=haste_exp,enchant=40agi,suffix=136
finger2=lightning_conductor_band,heroic=1,ilevel=372,quality=epic,stats=215agi_143crit_143hit_322sta,reforge=crit_mastery,enchant=40agi
trinket1=darkmoon_card_hurricane,ilevel=359,quality=epic,stats=321agi,equip=onattackhit_-5000nature_1ppm
trinket2=fluid_death,ilevel=359,quality=epic,stats=321hit,equip=onattackhit_38agi_10stack_15dur
back=cloak_of_biting_chill,heroic=1,ilevel=372,quality=epic,stats=215agi_673armor_143crit_143mastery_322sta,reforge=crit_hit,enchant=65crit
main_hand=andoros_fist_of_the_dragon_king,heroic=1,ilevel=372,quality=epic,stats=165int_110mastery_110spi_2207sp_247sta,reforge=spi_hit,enchant=landslide,weapon=mace_1.80speed_328min_611max
off_hand=crulkorak_the_lightnings_arc,heroic=1,ilevel=372,quality=epic,stats=165agi_110crit_110haste_248sta,reforge=haste_exp,enchant=landslide,weapon=axe_2.60speed_949min_1764max
ranged=relic_of_golganneth,ilevel=359,quality=epic,stats=107agi_72crit_72haste_161sta,reforge=crit_exp,gems=40agi
tabard=gnomeregan_tabard,ilevel=1
# Gear Summary # gear_strength=20
# gear_agility=4591
# gear_stamina=5774
# gear_intellect=185
# gear_spirit=86
# gear_spell_power=2207
# gear_attack_power=190
# gear_expertise_rating=481
# gear_hit_rating=1671
# gear_crit_rating=908
# gear_haste_rating=591
# gear_mastery_rating=1760
# gear_armor=15382
# meta_gem=agile_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# main_hand=andoros_fist_of_the_dragon_king,heroic=1,weapon=mace_1.80speed_328min_611max,enchant=landslide
# off_hand=crulkorak_the_lightnings_arc,heroic=1,weapon=axe_2.60speed_949min_1764max,enchant=landslide

Warlock_AffDrain_T11_372_PTR : 29159dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
29159.0 11.62 / 0.04% 18.7 1557.7 1521.4 mana 0.00% 35.8
Origin http://chardev.org/?profile=36745
Talents http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • unstable_affliction
  • haunt

Charts

http://6.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:77568|22566|21959|16824|16611|15876|13309|11349|9644|4450|1250|518&chds=0,155136&chco=9482C9,435133,9482C9,9482C9,9482C9,9482C9,C41F3B,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++77568++unstable_affliction,9482C9,0,0,15|t++22566++fel_flame,435133,1,0,15|t++21959++shadow_bite,9482C9,2,0,15|t++16824++shadowflame,9482C9,3,0,15|t++16611++drain_soul,9482C9,4,0,15|t++15876++shadow_bolt,9482C9,5,0,15|t++13309++soul_fire,C41F3B,6,0,15|t++11349++haunt,9482C9,7,0,15|t++9644++drain_life,9482C9,8,0,15|t++4450++doombolt,9482C9,9,0,15|t++1250++felhunter_melee,C79C6E,10,0,15|t++518++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_AffDrain_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:16,15,15,14,12,9,4,4,3,3,1,1,1,1,0,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C41F3B,9482C9,9482C9,435133,9482C9,C79C6E,C41F3B,C41F3B&chl=shadow_bite|unstable_affliction|drain_life|corruption|drain_soul|bane_of_doom|haunt|felhunter_melee|shadowflame_dot|shadow_bolt|doombolt|fel_flame|shadowflame|ebon_imp_melee|soul_fire|darkmoon_card_volcano&chtt=Warlock_AffDrain_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7864zvutssruuusrqrqoonnnnmmllmljigghhggffggfdbacccbbabccbaZbbaZYXZaZZYXYYXWVVXXXWVVWWVUUTVVUUTTUUUTTSUUUUUTVWVUTTUUUUTTUUSRRQRRRRQQRRRRQQRRRQQQSSSRRQSTSSRRTUTTSRTTSSRRSSSRRQSSRRQQRRRRQPRRQQPPRSRRRQTTSSRRSTSSRRSSSRRQSSRRQQRSRRQQRRRQQQRSRRQQSSRQQPRRRQQQRSRRQQRRRQQQRRRQQPRRQQQPRRQQPPRRRRQQSSSSRRTTTSSSTUTTSSTTSSRRTTTTSSTUTTSSUUUUUTVWVVVVXXXXXWYZYYYYZaZZZYaaaaaZbbbaZYZZZYXXZZZYYYabaaaZbccbbbddddcceeeeddfffeeegggggfhhhhhhijjjiikkkjjikkkkjjlmllllmmmmmmn&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=105228&chtt=Warlock_AffDrain_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:fhnpnppqwwwy014585645310z010zttrrqqonmqqpnnnmmljihjjjlkkmmlhgfghhfeehiifffdddbbbddddeefffccceffeeeijjhiijjjhiijkkjkjlllihhjjjhhgikkjjjjiihhgiiihijllljhgiihgffhijhhhiffdcceeedeefffdccdeecddfghgggiggfffhhhfggiiiggfhhgfffhhihhhjiigfghhhgghjjjiihiiihhhijkjjjkkiggghhheefhihggffffdddfghhiikkjhhhijjhhiklkjihihhfffhhhghhkjjhhhkkkjjknoonooppomnnoopnoopppmlkllljjjlmmkkkllkjjkmnnmnorssqpprrrqqqsstrrqrqpnmmnnnmmnpppnmlnnnlmmoqrppprrrppqsstrstvwwttstuvtuuvvwuu&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=29159|max=47634&chxp=1,1,61,100&chtt=Warlock_AffDrain_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,2,5,6,4,18,39,35,62,84,93,169,179,213,321,387,398,478,526,540,596,553,607,603,603,511,476,419,385,305,296,248,174,149,118,92,74,59,55,38,19,23,9,9,9,1,4,2,2,1&chds=0,607&chbh=5&chxt=x&chxl=0:|min=27124|avg=29159|max=31325&chxp=0,1,48,100&chtt=Warlock_AffDrain_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_AffDrain_T11_372_PTR 29159
bane_of_doom 2618 9.0% 7.6 60.79sec 154772 151299 0 0 0 0.0% 0.1% 0.0% 0.0% 29 30206 62320 32.8% 0.0% 96.4%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.64 7.64 29.04 29.04 1.0230 15.0000 1183143
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.5 67.21% 30205.65 19289 47225 589660
crit 9.5 32.79% 62319.71 39637 97041 593483

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 4085 14.0% 1.0 1.04sec 1843939 1778218 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6242 12896 39.8% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.00 1.00 207.58 207.58 1.0370 2.1677 1845967
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 124.9 60.16% 6242.11 3716 11226 779522
crit 82.7 39.84% 12895.89 7635 23068 1066445

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.2% 10.1 46.54sec 3088 0 2698 4167 4873 26.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.11 10.11 0.00 0.00 0.0000 0.0000 31223
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 73.08% 2697.68 2601 3154 19933
crit 2.7 26.80% 4166.65 4019 4873 11290
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 4270 14.6% 101.2 3.29sec 19060 9644 0 0 0 0.0% 0.1% 0.0% 0.0% 229 6639 13749 24.9% 0.0% 36.4%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
101.22 101.22 229.46 229.46 1.9764 0.7172 1929318
Direct Results Count Pct Average Min Max Total Damage
hit 101.1 99.89% 0.00 0 0 0
miss 0.1 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 172.4 75.13% 6639.41 3848 11119 1144522
crit 57.1 24.87% 13749.49 7907 22847 784796

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3548 12.2% 13.1 8.75sec 122604 16611 0 0 0 0.0% 0.1% 0.0% 0.0% 42 30138 62298 24.8% 0.0% 20.7%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.08 13.08 42.07 42.07 7.3809 2.2217 1603420
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.6 75.19% 30137.78 18026 50474 953192
crit 10.4 24.81% 62297.88 37042 103717 650228

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards$?s58070[ and $58068s1% of $G his:her; total mana][]. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 320 1.1% 5.7 32.00sec 25427 22566 20087 41700 61535 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.69 5.69 0.00 0.00 1.1268 0.0000 144595
Direct Results Count Pct Average Min Max Total Damage
hit 4.3 75.09% 20086.52 17884 29946 85769
crit 1.4 24.81% 41699.73 36749 61535 58826
miss 0.0 0.11% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 1296 4.4% 45.2 9.99sec 12953 11349 10287 21281 32226 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
45.22 45.04 0.00 0.00 1.1414 0.0000 585696
Direct Results Count Pct Average Min Max Total Damage
hit 33.8 75.07% 10286.79 8952 16263 347784
crit 11.2 24.82% 21280.52 18394 32226 237912
miss 0.0 0.10% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.557700
  • base_dd_min:922.01
  • base_dd_max:922.01
life_tap 0 0.0% 4.6 48.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.64 4.64 0.00 0.00 1.0142 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.6 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 797 2.7% 20.2 16.04sec 17861 15876 14132 29267 46376 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
20.17 20.17 0.00 0.00 1.1251 0.0000 360304
Direct Results Count Pct Average Min Max Total Damage
hit 15.2 75.13% 14131.98 12503 22569 214186
crit 5.0 24.75% 29267.48 25691 46376 146118
miss 0.0 0.12% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1090 3.7% 25.9 13.13sec 18998 16824 2608 5382 7036 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.93 25.93 0.00 0.00 1.1292 0.0000 85382
Direct Results Count Pct Average Min Max Total Damage
hit 19.5 75.11% 2608.33 2406 3424 50808
crit 6.4 24.77% 5381.99 4943 7036 34574
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 901 3.1% 25.9 13.13sec 15706 0 0 0 0 24.8% 0.1% 0.0% 0.0% 113 2848 5892 24.9% 0.0% 35.8%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.93 25.93 112.95 112.95 0.0000 1.4328 407316
Direct Results Count Pct Average Min Max Total Damage
hit 19.5 75.09% 0.00 0 0 0
crit 6.4 24.81% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 84.8 75.10% 2848.13 2488 4163 241612
crit 28.1 24.90% 5892.46 5113 8554 165704

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 99 0.3% 3.0 46.24sec 14905 13309 11613 23962 29065 26.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 1.1200 0.0000 44716
Direct Results Count Pct Average Min Max Total Damage
hit 2.2 73.09% 11612.80 9321 14145 25465
crit 0.8 26.78% 23961.87 19153 29065 19251
miss 0.0 0.13% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4392 15.1% 22.5 15.38sec 88049 77568 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6704 13855 39.8% 0.0% 99.2%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.54 22.54 207.74 207.74 1.1351 2.1572 1984520
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.0 60.16% 6704.33 3971 12004 837922
crit 82.8 39.84% 13854.72 8159 24667 1146599

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.30
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - felhunter 5958
felhunter_melee 1249 21.0% 303.1 1.49sec 1862 1250 1677 3376 4394 16.8% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: felhunter_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
303.07 303.07 0.00 0.00 1.4900 0.0000 564274
Direct Results Count Pct Average Min Max Total Damage
hit 179.2 59.14% 1676.58 1545 2197 300486
crit 51.0 16.83% 3376.18 3090 4394 172218
glance 72.7 23.99% 1259.54 1159 1648 91569
dodge 0.1 0.04% 0.00 0 0 0

Action details: felhunter_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 4709 79.0% 75.9 6.00sec 28048 21959 22335 44834 70628 26.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.88 75.88 0.00 0.00 1.2773 0.0000 2128153
Direct Results Count Pct Average Min Max Total Damage
hit 55.1 72.63% 22335.14 9630 35402 1230943
crit 20.0 26.37% 44834.46 19212 70628 897209
miss 0.8 0.99% 0.00 0 0 0

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Bite the enemy, causing ${$M1+(1.228*($SP*0.5))} Shadow damage plus an additional $s3% damage for each of your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:500.17
  • base_dd_max:712.37
pet - doomguard 3905
doombolt 3905 100.0% 21.0 2.10sec 9352 4450 7807 15774 20699 26.2% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.1015 0.0000 196398
Direct Results Count Pct Average Min Max Total Damage
hit 14.6 72.77% 7806.83 6612 10375 113618
crit 5.2 26.24% 15773.65 13191 20699 82780
miss 0.2 0.99% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 206
ebon_imp_melee 206 100.0% 103.1 0.78sec 791 518 822 1644 1644 16.8% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
103.12 103.12 0.00 0.00 1.5284 0.0000 81618
Direct Results Count Pct Average Min Max Total Damage
hit 46.1 44.68% 822.05 822 822 37877
crit 17.3 16.79% 1644.11 1644 1644 28466
glance 24.8 24.03% 616.54 617 617 15275
dodge 6.7 6.48% 0.00 0 0 0
miss 8.3 8.02% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_AffDrain_T11_372_PTR
bane_of_doom mana 3.3% 50.2 3082
corruption mana 0.2% 1495.5 1233
demon_soul mana 1.4% 0.0 2367
drain_life mana 35.5% 7.7 2466
drain_soul mana 5.3% 42.6 2877
fel_flame mana 1.0% 20.6 1233
haunt mana 15.8% 5.3 2466
shadow_bolt mana 5.0% 10.2 1746
shadowflame mana 18.9% 3.7 5138
soul_fire mana 0.8% 8.1 1849
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 9.9% 28.6 3082
pet - felhunter
shadow_bite mana 100.0% 49.0 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29188.9 16.1 1.0%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 4.6 153132.0 32976.3 0.0%
mana_feed mana 20.0 356168.8 17798.1 3.1%
mp5_regen mana 1808.8 91943.7 50.8 1.0%
replenishment mana 1808.8 51173.2 28.3 1.0%
pet - felhunter mana
initial_mana none 1.0 61978.4 61978.4 0.0%
mana_feed mana 4.6 750.6 161.6 99.2%
mana_spring_totem mana 1808.8 16576.3 9.2 43.8%
mp5_regen mana 1808.8 9127.1 5.0 41.4%
replenishment mana 1808.8 16774.5 9.3 43.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.5sec 106.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 67.8 0.0 6.7sec 6.7sec 15% 15%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.5sec 46.5sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_felhunter 4.3 0.0 120.8sec 120.8sec 19% 19%

Database details

  • id:79460
  • cooldown name:buff_demon_soul_felhunter
  • tooltip:Periodic shadow damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.8sec 33.3sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.3 43.7 293.9sec 10.0sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.9 0.0 47.5sec 47.5sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.2 63.9 321.2sec 6.9sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic Shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 23.2 2.7 18.4sec 16.5sec 15% 100%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 46.2sec 46.2sec 0% 1%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.9sec 79.4sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.7sec 363.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
felhunter-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.3sec
shadow_trance 25.8 16.5sec

Statistics & Data Analysis

DPS
Population
Convergence 68.91%
σ of the average dps 5.8105
2 * σ / μ 0.0399%
95% Confidence Intervall ( μ ± 2σ ) ( 29147.36 - 29170.60 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 29141.55 - 29176.41 )
Sample Data
σ 581.0471
Minimum 27123.80
Maximum 31324.55
Spread ( max - min ) 4200.75
Range ( max - min ) / 2 2100.38
Range% 7.20
10th Percentile 28323.18
90th Percentile 29753.54
( 90th Percentile - 10th Percentile ) 1430.36
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1588
0.1 scale factor error with delta=300 3001
0.05 scale factor error with delta=300 12004
0.01 scale factor error with delta=300 300102
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_felhunter
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 corruption,if=(!ticking|remains<tick_time)&miss_react
A unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
B bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
C haunt
D fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
E summon_doomguard
F drain_soul,interrupt=1,if=target.health_pct<=25
G shadowflame
H soulburn
I soul_fire,if=buff.soulburn.up
J shadow_bolt,if=buff.shadow_trance.react
K life_tap,mana_percentage<=5
L drain_life,interrupt=1
M life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
N fel_flame,moving=1
O life_tap

Sample Sequence

012346789ABCEGHILLLCLALGLLCLLLAGLCJLLLLCAGLLLCHILAGJLCBLLLACGLLLJLCLGALLCJLLJGHICLALLKLCGLLALC68JLBGDLCLJDLJGCLALLLCLGLLACLJLGLCLALLGCLLBALCGKLLLCLAGLLJCDLJLDGLCLLALCGKLLJLACL68GLBLCLALGLLCLDDLGCLLLLACGKLLLCLJGLALCLLDGBCLDLLLCAGLLLCLJGLALCLLLGCLAJLLCGLLA68LCLBGJLLCLALGKLCJLLJACGLLLCLAGKFCFCFBFCF7FCFCFCFCF68FCFBFCFCFCFCFCF

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 152668 128504 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 0
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_AffDrain_T11_372_PTR
origin="http://chardev.org/?profile=36745"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032123002000000000000000300000000000000000
glyphs=life_tap/shadow_bolt/corruption/unstable_affliction/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_felhunter
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_doomguard
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/soulburn
actions+=/soul_fire,if=buff.soulburn.up
actions+=/shadow_bolt,if=buff.shadow_trance.react
actions+=/life_tap,mana_percentage<=5
actions+=/drain_life,interrupt=1
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Affliction_T11_372_PTR : 28955dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28954.8 11.48 / 0.04% 20.8 1393.9 1229.8 mana 0.00% 36.1
Origin http://chardev.org/?profile=36750
Talents http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • corruption
  • unstable_affliction
  • haunt

Charts

http://7.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:78560|22885|21063|16996|16603|13900|11485|9800|4451|1250|518&chds=0,157119&chco=9482C9,435133,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C79C6E&chm=t++78560++unstable_affliction,9482C9,0,0,15|t++22885++fel_flame,435133,1,0,15|t++21063++shadow_bite,9482C9,2,0,15|t++16996++shadowflame,9482C9,3,0,15|t++16603++drain_soul,9482C9,4,0,15|t++13900++drain_life,9482C9,5,0,15|t++11485++haunt,9482C9,6,0,15|t++9800++shadow_bolt,9482C9,7,0,15|t++4451++doombolt,9482C9,8,0,15|t++1250++felhunter_melee,C79C6E,9,0,15|t++518++ebon_imp_melee,C79C6E,10,0,15&chtt=Warlock_Affliction_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:16,15,14,14,12,9,4,4,4,3,2,1,1,1,0&chds=0,100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,C41F3B,9482C9,435133,9482C9,C79C6E,C41F3B&chl=shadow_bite|unstable_affliction|corruption|shadow_bolt|drain_soul|bane_of_doom|haunt|drain_life|felhunter_melee|shadowflame_dot|doombolt|fel_flame|shadowflame|ebon_imp_melee|darkmoon_card_volcano&chtt=Warlock_Affliction_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7764ztrqppooonmmkjigggffeddccbaYXXadfkmmllkkihfffeeedefgijklmnnmmmlllkjihgffeeeddcbbaZYYYZbdfhijkjjihhggfffeeeddccbbbbccefghggffeedccbbaaZZYZacfikllllkjiihggffeedccbbaaZZabcdeghhiiiihhgfedddddegiklmnnnmmllkkjiihggffeddcbbaaZZaaabcdfghhiiihhgfeeeeefgghiiiiiiiiiihhggffeedccbbaaaabbdefghiiiihhggfffeeeddccccbbbbbcddeeeeeeeddccbbbbbbbccdeeffffffeeedddcccbbbaaaZZZZZZYYYYYYYXXXXXXXXXXXXXXXXXYYYYYYYXXXXXXXXXXXXXXXXXXXXXXXXWXXXXXXWWWWVVVUUUUUUUUUUUUUUTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|max=105228&chtt=Warlock_Affliction_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:gipqprqrxxxy015585544321z0zzysrqrqqoonrqpnnnllkjiikjjkkklkkgffhhgfeeghhfffdddcccdddcddfffdccdeedddghihhiiiihhhjjjjklmmmjiikkkiiikllkkkjihggghhhgghjjjhgfgggfffhijhhhigfdddeedcdefffdccdddccceefeffhgfeeegggfffiiihgghhgfffhhihhhjiifffhhhggikkkjiijjjiiikklkkklkjggfhhgeeeghhfffffedddffgfghjjjhhgiiihhhkkljjijiiggghhhghhjkjihhjjkjjjmnonnnppommmooomnnpppnmlmmmjjkmmmlllmmmkkknnnmnoqrrqpprrrqqqrrsqqrsrronnooommnppponnoonmmmopqppqssrppqsssrrsuvvuutuuvtuuvwxuv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=451|1:|0|avg=28955|max=47322&chxp=1,1,61,100&chtt=Warlock_Affliction_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,3,6,6,20,27,32,52,71,92,113,135,236,262,292,397,391,496,482,541,553,590,599,567,532,484,460,434,392,322,270,228,210,176,134,98,71,70,46,38,24,13,11,6,5,4,3,1,1,2&chds=0,599&chbh=5&chxt=x&chxl=0:|min=27002|avg=28955|max=31046&chxp=0,1,48,100&chtt=Warlock_Affliction_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Affliction_T11_372_PTR 28955
bane_of_doom 2614 9.0% 7.6 60.98sec 155008 152574 0 0 0 0.0% 0.1% 0.0% 0.0% 29 30221 62408 32.8% 0.0% 96.1%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.62 7.62 28.95 28.95 1.0159 15.0000 1181158
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 19.4 67.15% 30221.43 19289 47225 587638
crit 9.5 32.85% 62408.15 39637 97041 593520

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.08
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 4111 14.2% 1.0 176.65sec 1809899 1741523 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6259 12931 39.8% 0.0% 99.6%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 208.36 208.36 1.0393 2.1596 1857680
Direct Results Count Pct Average Min Max Total Damage
hit 1.0 99.86% 0.00 0 0 0
miss 0.0 0.14% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.4 60.18% 6259.02 4162 10830 784826
crit 83.0 39.82% 12931.25 8552 23068 1072854

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 69 0.2% 10.1 46.71sec 3086 0 2695 4164 4873 26.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.08 10.08 0.00 0.00 0.0000 0.0000 31099
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 73.00% 2694.78 2601 3154 19824
crit 2.7 26.87% 4164.10 4019 4873 11276
miss 0.0 0.12% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.30 4.30 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
drain_life 1267 4.4% 18.3 16.89sec 31197 13900 0 0 0 0.0% 0.1% 0.0% 0.0% 55 8179 16990 25.3% 0.0% 8.1%

Stats details: drain_life

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
18.35 18.35 54.99 54.99 2.2443 0.6651 572417
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 99.90% 0.00 0 0 0
miss 0.0 0.10% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 41.1 74.68% 8179.19 4440 10635 335901
crit 13.9 25.32% 16989.81 9124 21854 236515

Action details: drain_life

Static Values
  • id:689
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s1 Shadow damage every $t1 seconds. Restoring $89653s1% of maximum health to the caster when Drain Life deals damage.
  • description:Drains the life from the target, causing $689s1 Shadow damage and restoring $89653s1% of the caster's total health every $689t1 sec. Lasts $689d.$?s74434[ |CFFE55BB0Soulburn: Cast time reduced by 50%.|R][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.172000
  • base_td:109.71
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
drain_soul 3541 12.2% 13.1 8.68sec 121701 16603 0 0 0 0.0% 0.1% 0.0% 0.0% 42 30152 62277 24.8% 0.0% 20.6%

Stats details: drain_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
13.15 13.15 41.99 41.99 7.3299 2.2214 1600052
Direct Results Count Pct Average Min Max Total Damage
hit 13.1 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 31.6 75.25% 30151.58 17154 50474 952700
crit 10.4 24.75% 62276.59 37042 103717 647353

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:$w1 Shadow damage every $t2 seconds.
  • description:Drains the soul of the target, causing $o1 Shadow damage over $d. If the target is at or below $s3% health, Drain Soul causes double the normal damage. If the target dies while being drained, and yields experience or honor, the caster gains 3 Soul Shards$?s58070[ and $58068s1% of $G his:her; total mana][]. Soul Shards are required for Soulburn.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.378000
  • base_td:76.99
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fel_flame 318 1.1% 5.6 32.54sec 25467 22885 20077 41636 61535 25.1% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.64 5.64 0.00 0.00 1.1128 0.0000 143707
Direct Results Count Pct Average Min Max Total Damage
hit 4.2 74.78% 20076.57 17884 29946 84721
crit 1.4 25.11% 41636.02 36749 61535 58986
miss 0.0 0.11% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
haunt 1282 4.4% 44.7 10.11sec 12961 11485 10299 21279 32226 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: haunt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
44.69 44.50 0.00 0.00 1.1285 0.0000 579231
Direct Results Count Pct Average Min Max Total Damage
hit 33.4 75.06% 10298.93 8952 15683 344023
crit 11.1 24.84% 21279.40 18394 32226 235208
miss 0.0 0.11% 0.00 0 0 0

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2466.0
  • cooldown:8.00
  • base_execute_time:1.35
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $ Shadow damage and increasing all damage done by your Shadow damage-over-time effects on the target by $s3% for $d. When the Haunt spell ends or is dispelled, the soul returns to you, healing you for $s2% of the damage it did to the target
Direct Damage
  • may_crit:true
  • direct_power_mod:0.557700
  • base_dd_min:922.01
  • base_dd_max:922.01
life_tap 0 0.0% 11.7 27.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
11.65 11.65 0.00 0.00 1.0069 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 11.7 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
shadow_bolt 3919 13.5% 102.1 3.11sec 17342 9800 13743 28396 42666 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.10 102.10 0.00 0.00 1.7695 0.0000 1770709
Direct Results Count Pct Average Min Max Total Damage
hit 76.8 75.22% 13742.85 12503 20764 1055467
crit 25.2 24.67% 28395.68 25691 42666 715242
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1068 3.7% 25.4 13.42sec 18998 16996 2607 5376 7036 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.39 25.39 0.00 0.00 1.1178 0.0000 83473
Direct Results Count Pct Average Min Max Total Damage
hit 19.1 75.22% 2607.33 2406 3424 49797
crit 6.3 24.67% 5376.35 4943 7036 33675
miss 0.0 0.12% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 883 3.0% 25.4 13.42sec 15711 0 0 0 0 24.9% 0.1% 0.0% 0.0% 111 2845 5886 24.8% 0.0% 35.1%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.39 25.39 110.80 110.80 0.0000 1.4302 398927
Direct Results Count Pct Average Min Max Total Damage
hit 19.0 74.96% 0.00 0 0 0
crit 6.3 24.93% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 83.3 75.16% 2845.27 2488 4163 236944
crit 27.5 24.84% 5886.24 5113 8554 161983

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soulburn 0 0.0% 3.0 118.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
unstable_affliction 4386 15.1% 22.6 15.39sec 87853 78560 0 0 0 0.0% 0.1% 0.0% 0.0% 208 6693 13825 39.9% 0.0% 99.2%

Stats details: unstable_affliction

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
22.56 22.56 207.84 207.84 1.1183 2.1558 1982063
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 99.89% 0.00 0 0 0
miss 0.0 0.11% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 125.0 60.14% 6693.45 3971 11588 836612
crit 82.9 39.86% 13825.11 8159 24667 1145451

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:1.30
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec. If dispelled, will cause $*9;w2 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o2 damage over $d. In addition, if the Unstable Affliction is dispelled it will cause $*9;s2 damage to the dispeller and silence them for $31117d. Only one Unstable Affliction or Immolate per Warlock can be active on any one target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:223.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - felhunter 5766
felhunter_melee 1249 21.7% 303.1 1.49sec 1862 1250 1676 3375 4394 16.9% 0.0% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: felhunter_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
303.07 303.07 0.00 0.00 1.4900 0.0000 564454
Direct Results Count Pct Average Min Max Total Damage
hit 179.1 59.10% 1676.35 1545 2197 300245
crit 51.2 16.88% 3375.19 3090 4394 172707
glance 72.7 23.98% 1259.28 1159 1648 91502
dodge 0.1 0.04% 0.00 0 0 0

Action details: felhunter_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_bite 4517 78.3% 75.9 6.00sec 26904 21063 21428 43036 70628 26.3% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bite

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
75.88 75.88 0.00 0.00 1.2773 0.0000 2041347
Direct Results Count Pct Average Min Max Total Damage
hit 55.1 72.65% 21428.45 9630 35402 1181156
crit 20.0 26.34% 43036.26 19212 70628 860192
miss 0.8 1.01% 0.00 0 0 0

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Bite the enemy, causing ${$M1+(1.228*($SP*0.5))} Shadow damage plus an additional $s3% damage for each of your damage over time effects on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.228000
  • base_dd_min:500.17
  • base_dd_max:712.37
pet - doomguard 3905
doombolt 3905 100.0% 21.0 2.10sec 9353 4451 7805 15789 20699 26.3% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.1015 0.0000 196420
Direct Results Count Pct Average Min Max Total Damage
hit 14.5 72.69% 7805.09 6612 10375 113477
crit 5.3 26.27% 15789.18 13191 20699 82942
miss 0.2 1.04% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 204
ebon_imp_melee 204 100.0% 102.3 0.78sec 791 518 822 1644 1644 16.8% 14.5% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.28 102.28 0.00 0.00 1.5284 0.0000 80936
Direct Results Count Pct Average Min Max Total Damage
hit 45.6 44.63% 822.05 822 822 37525
crit 17.2 16.78% 1644.11 1644 1644 28220
glance 24.6 24.09% 616.54 617 617 15190
dodge 6.7 6.53% 0.00 0 0 0
miss 8.1 7.97% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Affliction_T11_372_PTR
bane_of_doom mana 3.7% 50.3 3082
corruption mana 0.2% 1467.9 1233
demon_soul mana 1.6% 0.0 2366
drain_life mana 7.2% 12.7 2466
drain_soul mana 6.0% 42.3 2877
fel_flame mana 1.1% 20.7 1233
haunt mana 17.5% 5.3 2466
shadow_bolt mana 28.3% 9.9 1746
shadowflame mana 20.7% 3.7 5138
soulburn soul_shards 100.0% 0.0 1
unstable_affliction mana 11.0% 28.5 3082
pet - felhunter
shadow_bite mana 100.0% 47.0 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29421.4 16.3 0.2%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 11.7 376202.5 32289.8 0.0%
mp5_regen mana 1808.8 92672.7 51.2 0.2%
replenishment mana 1808.8 51540.4 28.5 0.2%
pet - felhunter mana
initial_mana none 1.0 61978.4 61978.4 0.0%
mana_spring_totem mana 1808.8 16863.5 9.3 42.8%
mp5_regen mana 1808.8 9289.4 5.1 40.3%
replenishment mana 1808.8 17075.5 9.4 42.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.6 0.0 106.5sec 106.5sec 20% 20%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.9sec 120.9sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 158.3 0.0 2.8sec 2.8sec 51% 51%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.7sec 46.7sec 26% 26%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_felhunter 4.3 0.0 120.9sec 120.9sec 19% 22%

Database details

  • id:79460
  • cooldown name:buff_demon_soul_felhunter
  • tooltip:Periodic shadow damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
eradication 9.5 3.0 44.6sec 33.2sec 24% 26%

Database details

  • id:64371
  • cooldown name:buff_eradication
  • tooltip:Spell casting speed increased by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:6.00%
haunted 1.5 42.9 209.2sec 10.1sec 98% 99%

Database details

  • id:48181
  • cooldown name:buff_haunted
  • tooltip:Damage taken from Shadow damage-over-time effects increased by $s3%.
  • max_stacks:1
  • duration:12.00
  • cooldown:8.00
  • default_chance:100.00%
power_torrent_mh 9.8 0.0 47.9sec 47.9sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
shadow_embrace 1.3 145.2 275.6sec 3.0sec 98% 99%

Database details

  • id:32389
  • cooldown name:buff_shadow_embrace
  • tooltip:Periodic Shadow damage taken increased by $s1%.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:300.00%
shadow_trance 15.4 3.4 28.2sec 22.9sec 17% 11%

Database details

  • id:17941
  • cooldown name:buff_shadow_trance
  • tooltip:Your next Shadow Bolt becomes an instant cast spell.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:8.00%
soulburn 3.0 0.0 118.3sec 118.3sec 0% 8%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.3 87.0sec 78.3sec 9% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.7sec 363.7sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
felhunter-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 5.8 63.9sec
shadow_trance 18.8 22.9sec

Statistics & Data Analysis

DPS
Population
Convergence 68.75%
σ of the average dps 5.7400
2 * σ / μ 0.0396%
95% Confidence Intervall ( μ ± 2σ ) ( 28943.32 - 28966.28 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.96% - 100.04% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28937.58 - 28972.02 )
Sample Data
σ 573.9961
Minimum 27002.24
Maximum 31045.96
Spread ( max - min ) 4043.72
Range ( max - min ) / 2 2021.86
Range% 6.98
10th Percentile 28117.00
90th Percentile 29553.62
( 90th Percentile - 10th Percentile ) 1436.62
Approx. Iterations needed for
1% dps error 15
0.1% dps error 1571
0.1 scale factor error with delta=300 2928
0.05 scale factor error with delta=300 11714
0.01 scale factor error with delta=300 292863
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_felhunter
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 corruption,if=(!ticking|remains<tick_time)&miss_react
A unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
B bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
C haunt
D fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
E summon_doomguard
F drain_soul,interrupt=1,if=target.health_pct<=25
G shadowflame
H life_tap,mana_percentage<=35
I soulburn,if=buff.demon_soul_felhunter.up
J drain_life,if=buff.demon_soul_felhunter.up
K shadow_bolt
L life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
M fel_flame,moving=1
N life_tap

Sample Sequence

012346789ABCEGIJJJCJAJGJCKDDKKKKCGKKAHKKCKGKKACKKKGHKCABKKKGCKKKAKCKGKKKACHKKGKKCKAKKKCGKKKK68ACHIJBGJCJAJJCGHKKAKCKGKKKCAKKKGKCKKHKKACGKKKBKCDKDGHKKCKAKKGCKKKKACGKKKKCKAGHKKC68IJJABGCHJJJCAGKKKKCKKGAKCKKKHGCAKKKKCKGKAKCBKKGHKCAKKKKGCKKKAKCKGHKKCAKKGKCKKK68AJCGHBDJJCDJGKKACHKKKGCKAKKKCKFCFCFBF7CFCFCFCFCF68FCBFCFCFCFCFC

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 7977 6289 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 149490 125956 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 28.66% 18.96% 2428
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 18.96% 18.96% 2428
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.91% 12.91% 881

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 2
Improved Life Tap 2
Improved Corruption 3
Jinx 1
Soul Siphon 2
Siphon Life 2
Curse of Exhaustion 1
Improved Fear 0
Eradication 3
Improved Howl of Terror 0
Soul Swap 1
Shadow Embrace 3
Death's Embrace 3
Nightfall 2
Soulburn: Seed of Corruption 0
Everlasting Affliction 3
Pandemic 2
Haunt 1
Demonology Rank
Demonic Embrace 1
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 0
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 0
Aftermath 0
Emberstorm 0
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Affliction_T11_372_PTR
origin="http://chardev.org/?profile=36750"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-22312210301332032113000000000000000003300000000000000000
glyphs=life_tap/shadow_bolt/corruption/unstable_affliction/haunt
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_felhunter
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/corruption,if=(!ticking|remains actions+=/unstable_affliction,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/bane_of_doom,if=target.time_to_die>15&!ticking&miss_react
actions+=/haunt
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.unstable_affliction.remains<8
actions+=/summon_doomguard
actions+=/drain_soul,interrupt=1,if=target.health_pct<=25
actions+=/shadowflame
actions+=/life_tap,mana_percentage<=35
actions+=/soulburn,if=buff.demon_soul_felhunter.up
actions+=/drain_life,if=buff.demon_soul_felhunter.up
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2428
# gear_mastery_rating=881
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Demonology_T11_372_PTR : 26938dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
26937.9 13.18 / 0.05% 16.6 1621.3 1531.9 mana 0.00% 42.7
Origin http://chardev.org/?profile=36757
Talents http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
Glyphs
  • life_tap
  • shadow_bolt
  • immolate
  • lash_of_pain
  • metamorphosis

Charts

http://8.chart.apis.google.com/chart?chs=550x390&cht=bhg&chf=bg,s,333333&chd=t:82716|69206|31284|23624|20725|16604|13339|12036|10161|7012|4630|512&chds=0,165431&chco=9482C9,C41F3B,9482C9,435133,9482C9,435133,C41F3B,C41F3B,9482C9,9482C9,9482C9,C79C6E&chm=t++82716++bane_of_doom,9482C9,0,0,15|t++69206++immolation_aura,C41F3B,1,0,15|t++31284++corruption,9482C9,2,0,15|t++23624++fel_flame,435133,3,0,15|t++20725++shadowflame,9482C9,4,0,15|t++16604++hand_of_guldan,435133,5,0,15|t++13339++incinerate,C41F3B,6,0,15|t++12036++soul_fire,C41F3B,7,0,15|t++10161++shadow_bolt,9482C9,8,0,15|t++7012++lash_of_pain,9482C9,9,0,15|t++4630++doombolt,9482C9,10,0,15|t++512++ebon_imp_melee,C79C6E,11,0,15&chtt=Warlock_Demonology_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x350&cht=p&chf=bg,s,333333&chd=t:26,17,11,7,7,6,6,6,4,3,2,2,2,1,0&chds=0,100&chco=9482C9,9482C9,C41F3B,9482C9,C41F3B,9482C9,435133,C41F3B,C41F3B,C41F3B,9482C9,435133,C79C6E,9482C9,C41F3B&chl=lash_of_pain|shadow_bolt|immolate|corruption|soul_fire|bane_of_doom|hand_of_guldan|shadowflame_dot|incinerate|immolation_aura|doombolt|fel_flame|ebon_imp_melee|shadowflame|darkmoon_card_volcano&chtt=Warlock_Demonology_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t8776551xxwwxwxxxwvvuvvvvvvvvvuttttttttttuussttttuvwvxyyyyxyzzyyyzzyyyyyxxxxxxxxxxwwwvvvvwwvvvuuvuuuuvvwwxxxwwwwvvvvwwwwwwwvuuuuuuuuttuuttttttttuuuuuvvvvwwxxxxxxxxxxwwwwwwwwwwwwvvvvvvuuttuutuuuuvvwwwwwwwwwwwwwwwwwwwwwwwvwwwwwwwwwwwvvvwwwwxxyyyyyyxyyyyyxxxxxwwwwwwwvwwvvvvvvvvvvvvvvvvvvvwwwwwwxxxxxxxxxxwwwwvvvvvvvvvvvuuuuuuuuuuuuuuvuvvvvvvvvvvwvvvvvvuuuuuuuuututtttssssssrrrrrrrrrrrrrssrsrrssrsrrrrrrrqrqqqqqqqpppppoopoooooooooonnnnonnoononnnnnnnnnmmmm&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=104366&chtt=Warlock_Demonology_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:pqsvux00022446777453444322ywvurqpponooonnlkjjhhhgggiijiiigffeffeedeeddccaZZYZZZZZZaaaaaaZabbccddfggghhhgggghhhhiiiiihgfffffeeeeefffedccccccddceeeeeddccccccbbcdccbbaZZZZZZZZabbbbaaZZZaabbbcdddeedddddeeeeeffffeeedddddedeeeeeeeeeddeeeeeefeeeeddddddddcddddddcbbbbbbbbbbbbbbbbaaabbbbbcddeeededeeeeeeeeeeeddcccccbbbccccccccccddeeeffgghhhggggggfggggggffeeddcccccccdcccbbbbbbbbcccdeeeedeeeeeffffffffeeeddddcddddddddccccccddeefffgfffffffggghhhihhggffffffgfggggg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=26938|max=51241&chxp=1,1,53,100&chtt=Warlock_Demonology_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:2,0,1,1,6,11,22,45,56,64,81,142,160,231,290,339,420,455,461,538,554,600,605,606,578,515,503,420,408,362,294,259,203,177,143,107,89,60,54,33,30,23,17,15,7,4,3,3,1,2&chds=0,606&chbh=5&chxt=x&chxl=0:|min=24749|avg=26938|max=28623&chxp=0,1,57,100&chtt=Warlock_Demonology_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Demonology_T11_372_PTR 26938
bane_of_doom 1643 6.1% 7.7 60.76sec 96654 82716 0 0 0 0.0% 0.1% 0.0% 0.0% 29 20162 41492 24.8% 0.0% 96.8%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.68 7.68 29.18 29.18 1.1685 15.0000 742614
Direct Results Count Pct Average Min Max Total Damage
hit 7.7 99.87% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 22.0 75.22% 20161.52 14593 34328 442582
crit 7.2 24.78% 41491.96 29987 70540 300033

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
corruption 1947 7.2% 24.2 18.69sec 36355 31284 0 0 0 0.0% 0.1% 0.0% 0.0% 197 3537 7311 24.9% 0.0% 99.0%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
24.21 24.21 196.65 196.65 1.1621 2.2754 880118
Direct Results Count Pct Average Min Max Total Damage
hit 24.2 99.88% 0.00 0 0 0
miss 0.0 0.12% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 147.8 75.14% 3537.45 2574 6356 522739
crit 48.9 24.86% 7311.46 5288 13060 357379

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 97 0.4% 10.1 46.63sec 4323 0 3771 5832 8444 27.0% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.14 10.14 0.00 0.00 0.0000 0.0000 43843
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.94% 3771.14 3052 5465 27896
crit 2.7 26.96% 5831.89 4715 8444 15947
miss 0.0 0.10% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 3.3 122.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.28 3.28 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 473 1.8% 7.8 35.89sec 27582 23624 21889 45299 82031 24.7% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.76 7.74 0.00 0.00 1.1675 0.0000 213939
Direct Results Count Pct Average Min Max Total Damage
hit 5.8 75.13% 21888.86 16137 39920 127238
crit 1.9 24.74% 45298.58 33159 82031 86701
miss 0.0 0.13% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
hand_of_guldan 1632 6.1% 31.3 14.49sec 23590 16604 18658 38649 68771 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.28 31.27 0.00 0.00 1.4207 0.0000 737855
Direct Results Count Pct Average Min Max Total Damage
hit 23.5 75.06% 18657.68 13931 33468 437883
crit 7.8 24.82% 38649.18 28627 68771 299972
miss 0.0 0.11% 0.00 0 0 0

Action details: hand_of_guldan

Static Values
  • id:71521
  • school:shadowflame
  • resource:mana
  • tree:demonology
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Summons a falling meteor down upon the enemy target, dealing $71521s1 Shadowflame damage and erupts an aura of magic within $86000a1 yards, causing all targets within it to have a $86000s1% increased chance to be critically hit by any Warlock demons. The aura lasts for $86041d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.968000
  • base_dd_min:1405.76
  • base_dd_max:1660.24
immolate 2847 10.6% 1.0 223.79sec 1246305 1232260 8427 17425 20265 26.5% 0.1% 0.0% 0.0% 196 5148 10644 24.9% 0.0% 99.1%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.03 1.03 195.66 195.66 1.0114 2.2891 1286685
Direct Results Count Pct Average Min Max Total Damage
hit 0.8 73.41% 8426.65 4297 9862 6387
crit 0.3 26.50% 17424.65 8829 20265 4767
miss 0.0 0.09% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 146.9 75.06% 5148.21 3781 8842 756091
crit 48.8 24.94% 10644.50 7769 18169 519441

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
immolation_aura 743 2.8% 5.0 95.41sec 67298 69206 0 0 0 0.0% 0.0% 0.0% 0.0% 0 3371 0 0.0% 0.1% 0.0%

Stats details: immolation_aura

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.99 4.99 0.00 99.75 0.9724 0.0000 335826
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 99.6 99.88% 3370.73 2914 4245 335826
miss 0.1 0.12% 0.00 0 0 0

Action details: immolation_dmg

Static Values
  • id:50590
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Ignites the area surrounds you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Direct Damage
  • may_crit:false
  • direct_power_mod:0.100000
  • base_dd_min:566.82
  • base_dd_max:566.82

Action details: immolation_aura

Static Values
  • id:50589
  • school:fire
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:13153.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Damaging all nearby enemies.
  • description:Ignites the area surrounding you, causing $50590s1 Fire damage to all nearby enemies every $50589t1 sec. Lasts $50589d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:15
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 1168 4.3% 31.7 12.36sec 16666 13339 13246 27415 49505 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.67 31.52 0.00 0.00 1.2494 0.0000 527817
Direct Results Count Pct Average Min Max Total Damage
hit 23.7 75.07% 13246.16 8886 24092 313419
crit 7.8 24.81% 27414.54 20320 49505 214398
miss 0.0 0.12% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
life_tap 0 0.0% 1.0 123.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.01 1.01 0.00 0.00 1.0053 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.0 100.00% 0.00 0 0 0

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • tree:affliction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You Life Tap for $s3% of your total health, converting $% of that into mana.
metamorphosis 0 0.0% 5.0 95.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.99 4.99 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.0 100.00% 0.00 0 0 0

Action details: metamorphosis

Static Values
  • id:47241
  • school:physical
  • resource:mana
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • description:You transform into a Demon for $47241d. This form increases your armor contribution from items by $47241s2%, damage by $47241s3%, reduces the chance you'll be critically hit by melee attacks by $54879s1% and reduces the duration of stun and snare effects by $54817s1%. You gain some unique demon abilities in addition to your normal abilities.
shadow_bolt 4559 16.9% 104.6 3.20sec 19708 10161 15584 32274 63081 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
104.57 104.57 0.00 0.00 1.9395 0.0000 2060836
Direct Results Count Pct Average Min Max Total Damage
hit 78.5 75.07% 15584.11 11281 30699 1223406
crit 25.9 24.81% 32274.05 23181 63081 837431
miss 0.1 0.11% 0.00 0 0 0

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1746.8
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.754000
  • base_dd_min:563.83
  • base_dd_max:629.46
shadowflame 1851 6.9% 34.5 13.17sec 24231 20725 2822 5818 9380 24.8% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.53 34.53 0.00 0.00 1.1691 0.0000 122946
Direct Results Count Pct Average Min Max Total Damage
hit 25.9 75.13% 2821.56 2171 4565 73204
crit 8.5 24.76% 5817.99 4460 9380 49741
miss 0.0 0.11% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1579 5.9% 34.5 13.17sec 20670 0 0 0 0 24.7% 0.1% 0.0% 0.0% 140 4036 8352 24.9% 0.0% 47.4%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
34.53 34.53 139.72 139.72 0.0000 1.5334 713773
Direct Results Count Pct Average Min Max Total Damage
hit 26.0 75.19% 0.00 0 0 0
crit 8.5 24.69% 0.00 0 0 0
miss 0.0 0.13% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 105.0 75.14% 4036.09 2919 7214 423741
crit 34.7 24.86% 8351.78 5998 14824 290031

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1845 6.8% 48.3 9.38sec 17257 12036 13874 28672 50370 24.9% 0.1% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
48.32 47.54 0.00 0.00 1.4337 0.0000 833825
Direct Results Count Pct Average Min Max Total Damage
hit 35.7 75.02% 13874.18 10933 24513 494778
crit 11.8 24.87% 28672.05 22467 50370 339047
miss 0.1 0.11% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 46.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - succubus 7036
lash_of_pain 7036 100.0% 301.0 1.51sec 10554 7012 7815 15654 23018 35.9% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: lash_of_pain

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
301.03 301.03 0.00 0.00 1.5051 0.0000 3177215
Direct Results Count Pct Average Min Max Total Damage
hit 189.8 63.06% 7814.60 6892 11538 1483378
crit 108.2 35.94% 15654.24 13750 23018 1693837
miss 3.0 1.00% 0.00 0 0 0

Action details: lash_of_pain

Static Values
  • id:7814
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:572.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An instant attack that lashes the target, causing ${$M1+(0.612*($SP*0.5))} Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.642000
  • base_dd_min:283.00
  • base_dd_max:314.00
pet - doomguard 4049
doombolt 4049 100.0% 30.0 2.13sec 9841 4630 7500 15063 20699 36.4% 1.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
30.00 29.00 0.00 0.00 2.1255 0.0000 295238
Direct Results Count Pct Average Min Max Total Damage
hit 18.1 62.58% 7500.42 6612 10375 136122
crit 10.6 36.43% 15062.52 13191 20699 159116
miss 0.3 0.99% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 463
ebon_imp_melee 463 100.0% 257.7 0.79sec 791 512 822 1644 1644 16.8% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
257.71 257.71 0.00 0.00 1.5458 0.0000 203866
Direct Results Count Pct Average Min Max Total Damage
hit 115.1 44.67% 822.05 822 822 94638
crit 43.2 16.77% 1644.11 1644 1644 71049
glance 61.9 24.03% 616.54 617 617 38179
dodge 16.8 6.50% 0.00 0 0 0
miss 20.7 8.03% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Demonology_T11_372_PTR
bane_of_doom mana 3.2% 31.4 3082
corruption mana 4.1% 29.5 1233
demon_soul mana 1.4% 0.0 3082
fel_flame mana 1.3% 22.4 1233
hand_of_guldan mana 6.1% 16.4 1438
immolate mana 0.2% 758.1 1644
immolation_aura mana 7.2% 6.4 10517
incinerate mana 12.4% 5.8 2877
shadow_bolt mana 24.9% 11.3 1746
shadowflame mana 24.2% 4.7 5138
soul_fire mana 12.2% 9.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - succubus
lash_of_pain mana 100.0% 18.5 572
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29119.5 16.1 1.3%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 100103.0 100103.0 0.0%
life_tap mana 1.0 28388.7 28054.8 0.0%
mana_feed mana 108.2 486264.9 4494.0 2.0%
mp5_regen mana 1808.8 91734.6 50.7 1.2%
replenishment mana 1808.8 51074.8 28.2 1.2%
pet - succubus mana
initial_mana none 1.0 60141.9 60141.9 0.0%
mana_feed mana 1.0 95.6 94.5 99.4%
mana_spring_totem mana 1808.8 8973.7 5.0 69.6%
mp5_regen mana 1808.8 154100.5 85.2 60.8%
replenishment mana 1808.8 8903.9 4.9 69.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bell_of_enraging_resonance 4.8 0.0 104.6sec 104.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.8sec 120.8sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 12%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 214.7 0.0 2.1sec 2.1sec 77% 77%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.1 0.0 46.6sec 46.6sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
decimation 1.0 53.3 56.2sec 2.1sec 24% 94%

Database details

  • id:63167
  • cooldown name:buff_decimation
  • tooltip:Your Soul Fire cast time is reduced by $s1%.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
demon_soul_succubus 3.3 0.0 122.0sec 122.0sec 15% 22%

Database details

  • id:79463
  • cooldown name:buff_demon_soul_succubus
  • tooltip:Shadow Bolt damage increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
hand_of_guldan 8.7 22.5 49.5sec 14.5sec 97% 97%

Database details

  • id:
  • cooldown name:buff_hand_of_guldan
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
metamorphosis 5.0 0.0 95.3sec 95.3sec 39% 68%

Database details

  • id:47241
  • cooldown name:buff_metamorphosis
  • tooltip:Demon Form. Armor contribution from items increased by $47241s2%. Chance to be critically hit by melee reduced by 6%. Damage increased by $47241s3%. Stun and snare duration reduced by $54817s1%.
  • max_stacks:1
  • duration:36.00
  • cooldown:0.00
  • default_chance:100.00%
molten_core 10.2 1.5 41.3sec 35.5sec 16% 100%

Database details

  • id:71165
  • cooldown name:buff_molten_core
  • tooltip:Increases damage done by $71165s1% and reduces cast time by $71165s3% of your Incinerate.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:6.00%
power_torrent_mh 9.9 0.0 47.8sec 47.8sec 26% 28%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 46.7sec 46.7sec 0% 6%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.9 0.1 83.6sec 82.1sec 2% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.2sec 363.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
succubus-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 100.0%

Procs

Count Interval
ebon_imp 14.6 29.3sec
impending_doom 25.1 16.1sec

Statistics & Data Analysis

DPS
Population
Convergence 56.05%
σ of the average dps 6.5899
2 * σ / μ 0.0489%
95% Confidence Intervall ( μ ± 2σ ) ( 26924.75 - 26951.11 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.95% - 100.05% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 26918.16 - 26957.70 )
Sample Data
σ 658.9921
Minimum 24748.55
Maximum 28622.63
Spread ( max - min ) 3874.08
Range ( max - min ) / 2 1937.04
Range% 7.19
10th Percentile 25883.94
90th Percentile 27218.79
( 90th Percentile - 10th Percentile ) 1334.85
Approx. Iterations needed for
1% dps error 23
0.1% dps error 2393
0.1 scale factor error with delta=300 3860
0.05 scale factor error with delta=300 15440
0.01 scale factor error with delta=300 386018
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_succubus
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 metamorphosis
9 immolation,if=buff.metamorphosis.remains>10
A bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
B immolate,if=!ticking&target.time_to_die>=4&miss_react
C corruption,if=(remains<tick_time|!ticking)&target.time_to_die>=6&miss_react
D fel_flame,if=buff.tier11_4pc_caster.react
E shadowflame
F hand_of_guldan
G incinerate,if=buff.molten_core.react
H soulburn
I soul_fire,if=buff.decimation.react|buff.soulburn.up
J summon_doomguard
K life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
L demon_soul
M shadow_bolt
N life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
O fel_flame,moving=1
P life_tap

Sample Sequence

012346789ABCEFHIJLMMMMMMEFCGGGMMMMEMFMMMCMMEMFMMHIMMCEMAFMMMMEMCFMMMMEMMF89CMHIEGGGMFMMEMCMGGFG6AEMGGGKCLMFEMMMMMMECFMMMMMEMFGCDDGGMEMFM89AMCEMMFMMMEMMCFMMMEMMMFMCMEMGGGFKMM6ECAMG89FGGELMMMMCFGEGGMMMMFECMMKMMMEFMMCMMAEMFMMMMCEMFMMMMEMMCFGGGMEMMM89FCMDD6EMMAFMMMCELMMFMMMEMMCFMGGEGMGGGFGCEGGIIIIFGEAGGCCII7IFEIIIIIIICEFIIIIIIIEIFGCGG89IIEII6FIIIACEIIIFIGGGEIIICFIIGEGGIIIFICEGGGIIIFIEI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8438 6652 5950
Intellect 5752 5069 4659
Spirit 197 197 20
Health 155860 131038 0
Mana 105953 96308 0
Spell Power 9446 7266 2207
Spell Hit 16.89% 16.89% 1730
Spell Crit 20.69% 14.64% 919
Spell Haste 27.20% 17.62% 2256
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 14.40% 14.40% 1730
Melee Crit 16.14% 8.19% 919
Melee Haste 17.62% 17.62% 2256
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 13.87% 13.87% 1053

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 0
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 3
Dark Arts 3
Fel Synergy 2
Demonic Rebirth 2
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 3
Demonic Empowerment 1
Improved Health Funnel 0
Molten Core 3
Hand of Gul'dan 1
Aura of Foreboding 2
Ancient Grimoire 2
Inferno 1
Decimation 2
Cremation 2
Demonic Pact 1
Metamorphosis 1
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 0
Backdraft 0
Shadowburn 0
Burning Embers 0
Soul Leech 0
Backlash 0
Nether Ward 0
Fire and Brimstone 0
Shadowfury 0
Nether Protection 0
Empowered Imp 0
Bane of Havoc 0
Chaos Bolt 0

Profile

#!./simc

warlock=Warlock_Demonology_T11_372_PTR
origin="http://chardev.org/?profile=36757"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warlock-00000000000000000033222003103122122113320200000000000000
glyphs=life_tap/shadow_bolt/immolate/lash_of_pain/metamorphosis
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_succubus
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/metamorphosis
actions+=/immolation,if=buff.metamorphosis.remains>10
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/immolate,if=!ticking&target.time_to_die>=4&miss_react
actions+=/corruption,if=(remains=6&miss_react
actions+=/fel_flame,if=buff.tier11_4pc_caster.react
actions+=/shadowflame
actions+=/hand_of_guldan
actions+=/incinerate,if=buff.molten_core.react
actions+=/soulburn
actions+=/soul_fire,if=buff.decimation.react|buff.soulburn.up
actions+=/summon_doomguard
actions+=/life_tap,if=mana_pct<=50&buff.bloodlust.down&buff.metamorphosis.down&buff.demon_soul_succubus.down
actions+=/demon_soul
actions+=/shadow_bolt
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=40int,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_hit,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_mastery,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4659
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1730
# gear_crit_rating=919
# gear_haste_rating=2256
# gear_mastery_rating=1053
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warlock_Destruction_T11_372_PTR : 27528dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27527.6 9.34 / 0.03% 13.0 2115.6 1982.7 mana 0.00% 49.0
Origin http://chardev.org/?profile=36761
Talents http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
Glyphs
  • life_tap
  • immolate
  • imp
  • conflagrate

Charts

http://9.chart.apis.google.com/chart?chs=550x420&cht=bhg&chf=bg,s,333333&chd=t:63230|54912|27616|26823|26265|22200|16972|15872|13414|10816|4677|4349|524&chds=0,126460&chco=9482C9,C41F3B,C41F3B,435133,9482C9,9482C9,C41F3B,9482C9,C41F3B,C41F3B,C41F3B,9482C9,C79C6E&chm=t++63230++bane_of_doom,9482C9,0,0,15|t++54912++immolate,C41F3B,1,0,15|t++27616++conflagrate,C41F3B,2,0,15|t++26823++fel_flame,435133,3,0,15|t++26265++corruption,9482C9,4,0,15|t++22200++shadowflame,9482C9,5,0,15|t++16972++chaos_bolt,C41F3B,6,0,15|t++15872++shadowburn,9482C9,7,0,15|t++13414++incinerate,C41F3B,8,0,15|t++10816++soul_fire,C41F3B,9,0,15|t++4677++firebolt,C41F3B,10,0,15|t++4349++doombolt,9482C9,11,0,15|t++524++ebon_imp_melee,C79C6E,12,0,15&chtt=Warlock_Destruction_T11_372_PTR+Damage+Per+Execute+Time&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x360&cht=p&chf=bg,s,333333&chd=t:17,17,14,13,7,6,6,5,5,4,2,2,1,1,1,0&chds=0,100&chco=C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,C41F3B,9482C9,C41F3B,C41F3B,9482C9,435133,9482C9,9482C9,9482C9,C79C6E,C41F3B&chl=firebolt|incinerate|immolate|conflagrate|soul_fire|shadowflame_dot|corruption|burning_embers|chaos_bolt|bane_of_doom|fel_flame|doombolt|shadowburn|shadowflame|ebon_imp_melee|darkmoon_card_volcano&chtt=Warlock_Destruction_T11_372_PTR+Damage+Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t864432yuwxwyyxwwvttrrrsstttssqpoonnmmmmmnpponmmmmmmoooopooooonnmmnnnoomllkkllllkllllkjjllkkkkkkkkjkjkklllllllkkkkkjjkjjkjihhgffeeeeffghggggffeeeeffgggggggggffgffffffeeeedddddddddcccccbbaaaaaabbbccccccccbbbbbaabbbbbaaaaZZZYYYYYYYYYYYYYYYYYYYYYXXXXXXWWWWWWWWWWVVVVVVVVVVVVUVUUUUTTTTUUUUUVVVVVVVVVVVVVVVUVUUUUUUTTTTTTTTTTTTTTTTTTTTTTTUUUUUUVUVVVVVVVVUUUUUUUUUTTUUUTTSSSRRRRRRRRRRSSTTTUUTUTTTTSTTTTTTTTTTTTTSSSSSSSSSSSSSSTTTTTTTTTUUUUUUUUUUUUUUUUUTTTTTTTT&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=105623&chtt=Warlock_Destruction_T11_372_PTR+Mana+Timeline&chts=dddddd,18&chco=2459FF http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bjklmoqrtxw01113457776222220zxtsrrqrqqqopopooonllkjkklmmkkjhiiiihggffgghhgdddeffffeeefffggffffghhiiiijjjjjjjjjjjkklmllkjjjjkkkkjjkklmmlkjjjklkkkkkklllkjjiiihhhhhhhggfffeeeeeeeffffeeeeeeffffgghhiiihggghhhhhhhhhiihhhhhhhhiijjjjjjjjjjjjjjjkllllkkkkkkkkkkjjjjjjihhhhhhggggggggffffffgghhiiiiiiiihhhhhhhhhhhggfffeeeeeffgghhhiiijjkklllmmmnnnmmmllkkkkjjiiihhggggfffgggghhggghhiijjkkllmmmlllkkkkkkjjjjiihhgggffffffgggghhhhhiijjkkllmmmmmmmmmllllllkkjjjiiiiiiiiih&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27528|max=46371&chxp=1,1,59,100&chtt=Warlock_Destruction_T11_372_PTR+DPS+Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,0,1,6,8,9,22,33,63,104,135,202,275,351,429,526,614,667,706,751,780,716,665,625,500,421,392,273,210,158,108,89,47,40,22,19,11,9,6,4,0,1,0,0,0,0,0,0,1&chds=0,780&chbh=5&chxt=x&chxl=0:|min=25615|avg=27528|max=29807&chxp=0,1,46,100&chtt=Warlock_Destruction_T11_372_PTR+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warlock_Destruction_T11_372_PTR 27528
bane_of_doom 1230 4.5% 7.7 60.07sec 71980 63230 0 0 0 0.0% 1.6% 0.0% 0.0% 29 15215 31418 24.8% 0.0% 95.9%

Stats details: bane_of_doom

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.72 7.72 28.91 28.91 1.1384 15.0000 555991
Direct Results Count Pct Average Min Max Total Damage
hit 7.6 98.43% 0.00 0 0 0
miss 0.1 1.57% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 21.7 75.22% 15215.40 12415 21366 330930
crit 7.2 24.78% 31418.09 25512 43903 225060

Action details: bane_of_doom

Static Values
  • id:603
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Banes the target with impending doom, causing $s1 Shadow damage every $T1 sec. When Bane of Doom deals damage, it has a $s2% chance to summon a Demon guardian. Only one target can have Bane of Doom at a time, only one Bane per Warlock can be active on any one target. Lasts for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.880000
  • base_td:1947.77
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
burning_embers 1398 5.1% 330.7 1.36sec 1910 0 0 0 0 24.4% 1.5% 0.0% 0.0% 448 1411 0 0.0% 0.0% 99.1%

Stats details: burning_embers

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
330.73 330.73 447.84 447.84 0.0000 1.0000 631823
Direct Results Count Pct Average Min Max Total Damage
hit 244.9 74.04% 0.00 0 0 0
crit 80.8 24.43% 0.00 0 0 0
miss 5.1 1.53% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 447.8 100.00% 1410.83 257 2141 631823

Action details: burning_embers

Static Values
  • id:85421
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:Your Soulfire and your Imp's Firebolt cause a Burning Ember damage-over-time effect on the target equal to a percentage of the damage done lasting $85421d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1555.03
  • num_ticks:7
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
chaos_bolt 1367 5.0% 31.1 14.56sec 19885 16972 15305 32072 43582 29.3% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
31.08 30.93 0.00 0.00 1.1716 0.0000 617998
Direct Results Count Pct Average Min Max Total Damage
hit 21.4 69.16% 15305.10 12101 21965 327426
crit 9.1 29.29% 32071.57 24866 43582 290572
miss 0.5 1.55% 0.00 0 0 0

Action details: chaos_bolt

Static Values
  • id:50796
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:1438.0
  • cooldown:12.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a bolt of chaotic fire at the enemy, dealing $s1 Fire damage. Chaos Bolt cannot be resisted, and pierces through all absorption effects.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:1311.57
  • base_dd_max:1665.89
conflagrate 3625 13.2% 51.9 8.76sec 31597 27616 22574 46448 74580 39.2% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
51.87 51.87 0.00 0.00 1.1441 0.0000 1639045
Direct Results Count Pct Average Min Max Total Damage
hit 30.7 59.26% 22573.76 18563 36295 693906
crit 20.3 39.23% 46448.50 38144 74580 945139
miss 0.8 1.52% 0.00 0 0 0

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3288.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly deals fire damage equal to $s2% of your Immolate's periodic damage on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:8739.10
  • base_dd_max:8739.10
corruption 1671 6.1% 25.2 18.13sec 29971 26265 0 0 0 0.0% 1.5% 0.0% 0.0% 199 2997 6196 24.8% 0.0% 98.3%

Stats details: corruption

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.21 25.21 199.35 199.35 1.1411 2.2298 755615
Direct Results Count Pct Average Min Max Total Damage
hit 24.8 98.50% 0.00 0 0 0
miss 0.4 1.50% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 149.9 75.19% 2996.52 2430 4391 449123
crit 49.5 24.81% 6195.90 4993 9023 306493

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • tree:affliction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:Corrupts the target, causing $o1 Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:147.24
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
darkmoon_card_volcano 109 0.4% 10.3 45.95sec 4784 0 4241 6553 7548 26.4% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: darkmoon_card_volcano

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
10.26 10.26 0.00 0.00 0.0000 0.0000 49099
Direct Results Count Pct Average Min Max Total Damage
hit 7.4 72.03% 4240.63 3817 4892 31353
crit 2.7 26.39% 6552.66 5898 7548 17746
miss 0.2 1.58% 0.00 0 0 0

Action details: darkmoon_card_volcano

Static Values
  • id:0
  • school:fire
  • resource:none
  • tree:Unknown
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Direct Damage
  • may_crit:true
  • direct_power_mod:0.100000
  • base_dd_min:1200.00
  • base_dd_max:1200.00
demon_soul 0 0.0% 4.3 120.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: demon_soul

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
4.31 4.31 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 4.3 100.00% 0.00 0 0 0

Action details: demon_soul

Static Values
  • id:77801
  • school:shadow
  • resource:mana
  • tree:demonology
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:3082.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:You and your summoned demon fuse souls, granting the Warlock a temporary power depending on the demon currently enslaved. Imp - Critical strike chance of your cast time Destruction spells increased by $79459m1% for $79459d. Voidwalker - All threat generated by you transferred to your Voidwalker for $79464d. Succubus - Shadow Bolt damage increased by $79463s1% for $79463d. Felhunter - Periodic shadow damage increased by $79460s1% for $79460d. Felguard - Spell haste increased by $79462s1% and fire and shadow damage done increased by $79462s2% for $79462d.
fel_flame 502 1.8% 7.4 37.43sec 30660 26823 24627 51110 74986 24.5% 1.6% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
7.40 7.38 0.00 0.00 1.1430 0.0000 226811
Direct Results Count Pct Average Min Max Total Damage
hit 5.5 73.90% 24627.17 20160 36492 134317
crit 1.8 24.52% 51110.18 41425 74986 92494
miss 0.1 1.57% 0.00 0 0 0

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • base_cost:1233.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy target, increasing the duration of Immolate or Unstable Affliction by $s2 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.302000
  • base_dd_min:220.76
  • base_dd_max:256.56
immolate 3821 13.9% 26.9 16.95sec 64293 54912 6365 13304 18528 30.4% 1.5% 0.0% 0.0% 199 5632 11804 30.8% 0.0% 98.8%

Stats details: immolate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
26.87 26.87 199.40 199.40 1.1708 2.2404 1727395
Direct Results Count Pct Average Min Max Total Damage
hit 18.3 68.04% 6364.72 5370 9017 116352
crit 8.2 30.44% 13304.38 11035 18528 108825
miss 0.4 1.52% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 138.0 69.19% 5632.40 4725 8084 777139
crit 61.4 30.81% 11803.90 9709 16611 725080

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:1644.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $s3 Fire damage every $t3 sec.
  • description:Burns the enemy for $s2 Fire damage and then an additional $o3 Fire damage over $d.$?s30108[ Only one Unstable Affliction or Immolate per Warlock can be active on any one target.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.220000
  • base_dd_min:665.94
  • base_dd_max:665.94
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.176000
  • base_td:422.47
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
incinerate 4623 16.8% 119.7 3.69sec 17456 13414 13375 28226 40653 29.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
119.73 119.20 0.00 0.00 1.3013 0.0000 2089888
Direct Results Count Pct Average Min Max Total Damage
hit 82.4 69.12% 13375.37 11099 19784 1101918
crit 35.0 29.37% 28226.20 22806 40653 987970
miss 1.8 1.52% 0.00 0 0 0

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • base_cost:2877.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s1 Fire damage to your target and an additional $/6;s1 Fire damage if the target is affected by an Immolate spell.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.539000
  • base_dd_min:510.06
  • base_dd_max:592.77
shadowburn 219 0.8% 5.4 17.53sec 18426 15872 14817 30570 42583 24.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.38 5.38 0.00 0.00 1.1609 0.0000 99173
Direct Results Count Pct Average Min Max Total Damage
hit 4.0 74.09% 14816.50 11832 20723 59084
crit 1.3 24.37% 30570.15 24313 42583 40090
miss 0.1 1.55% 0.00 0 0 0

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:3082.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly blasts the target for $17877s2 Shadow damage. If the target dies within $29341d of Shadowburn, and yields experience or honor, the caster gains $29341s1 Soul Shards. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.056000
  • base_dd_min:649.32
  • base_dd_max:724.90
shadowflame 1892 6.9% 33.6 13.49sec 25422 22200 2162 4459 5677 24.4% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowflame

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.65 33.65 0.00 0.00 1.1451 0.0000 90482
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 74.07% 2161.68 1848 2842 53878
crit 8.2 24.40% 4459.05 3797 5677 36604
miss 0.5 1.53% 0.00 0 0 0

Action details: shadowflame

Static Values
  • id:47897
  • school:shadow
  • resource:mana
  • tree:destruction
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:5138.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.102000
  • base_dd_min:668.14
  • base_dd_max:731.10
shadowflame_dot 1692 6.1% 33.6 13.49sec 22732 0 0 0 0 24.5% 1.5% 0.0% 0.0% 134 4498 9304 24.9% 0.0% 44.5%

Stats details: shadowflame_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
33.65 33.65 134.33 134.33 0.0000 1.4988 764893
Direct Results Count Pct Average Min Max Total Damage
hit 24.9 73.94% 0.00 0 0 0
crit 8.3 24.55% 0.00 0 0 0
miss 0.5 1.51% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 100.9 75.12% 4498.17 3646 6595 453906
crit 33.4 24.88% 9304.01 7493 13551 310988

Action details: shadowflame_dot

Static Values
  • id:47960
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:Targets in a cone in front of the caster take $47897s1 Shadow damage and an additional $47960o1 Fire damage over $47960d.$?s63310[ Also reduces movement speed by $63310s1% to afflicted targets.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:162.63
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 1799 6.5% 39.1 11.44sec 20814 10816 16017 33452 46054 29.3% 1.5% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.09 38.94 0.00 0.00 1.9244 0.0000 813559
Direct Results Count Pct Average Min Max Total Damage
hit 26.9 69.14% 16016.70 13667 22412 431229
crit 11.4 29.35% 33451.80 28083 46054 382331
miss 0.6 1.51% 0.00 0 0 0

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • tree:destruction
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • base_cost:1849.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s74434[ |CFFE55BB0Soulburn: Instant cast.|R][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.628000
  • base_dd_min:2171.91
  • base_dd_max:2722.53
soulburn 0 0.0% 3.0 45.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.00 3.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.0 100.00% 0.00 0 0 0

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shards
  • tree:demonology
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:1.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • description:Consumes a Soul Shard, allowing you to use the secondary effects on some of your spells. Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
pet - imp 4674
firebolt 4674 100.0% 300.1 1.51sec 7040 4677 5694 11441 16995 26.1% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
300.07 298.40 0.00 0.00 1.5051 0.0000 2112323
Direct Results Count Pct Average Min Max Total Damage
hit 214.5 71.88% 5693.66 4983 8519 1221301
crit 77.9 26.10% 11441.30 9942 16995 891022
miss 6.0 2.02% 0.00 0 0 0

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:mana
  • tree:Unknown
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • base_cost:632.0
  • cooldown:0.00
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals ${$*$} Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.649000
  • base_dd_min:111.86
  • base_dd_max:124.88
pet - doomguard 3628
doombolt 3628 100.0% 21.0 2.08sec 9041 4349 7636 15412 20672 25.8% 2.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: doombolt

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.00 20.00 0.00 0.00 2.0790 0.0000 189865
Direct Results Count Pct Average Min Max Total Damage
hit 14.4 72.17% 7635.73 6599 10362 110208
crit 5.2 25.84% 15412.38 13164 20672 79657
miss 0.4 1.99% 0.00 0 0 0

Action details: doombolt

Static Values
  • id:85692
  • school:shadow
  • resource:mana
  • tree:Unknown
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.950000
  • base_dd_min:1280.13
  • base_dd_max:1429.13
pet - ebon_imp 205
ebon_imp_melee 205 100.0% 102.9 0.77sec 792 524 822 1644 1644 16.8% 14.5% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: ebon_imp_melee

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
102.85 102.85 0.00 0.00 1.5120 0.0000 81448
Direct Results Count Pct Average Min Max Total Damage
hit 46.0 44.74% 822.05 822 822 37827
crit 17.3 16.79% 1644.11 1644 1644 28394
glance 24.7 24.01% 616.54 617 617 15227
dodge 6.7 6.50% 0.00 0 0 0
miss 8.2 7.96% 0.00 0 0 0

Action details: ebon_imp_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Resources

Resource Usage Type Res% DPR RPE
Warlock_Destruction_T11_372_PTR
bane_of_doom mana 2.5% 23.4 3082
chaos_bolt mana 4.7% 13.8 1438
conflagrate mana 17.8% 9.6 3288
corruption mana 3.3% 24.3 1233
demon_soul mana 1.1% 0.0 2367
fel_flame mana 1.0% 24.9 1233
immolate mana 4.6% 39.1 1644
incinerate mana 36.0% 6.1 2877
shadowburn mana 1.7% 6.0 3082
shadowflame mana 18.1% 4.9 5138
soul_fire mana 7.6% 11.3 1849
soulburn soul_shards 100.0% 0.0 1
pet - imp
firebolt mana 100.0% 11.1 632
Resource Gains Type Count mana Average Overflow
blessing_of_might mana 1808.8 29344.0 16.2 0.5%
flask mana 1.0 4500.0 4500.0 0.0%
food mana 1.0 1350.0 1350.0 0.0%
initial_mana none 1.0 99773.0 99773.0 0.0%
life_tap mana 0.8 22443.1 27480.2 0.0%
mana_feed mana 77.9 356704.4 4580.3 0.1%
mp5_regen mana 1808.8 92429.8 51.1 0.5%
replenishment mana 1808.8 51346.4 28.4 0.5%
soul_leech mana 74.1 338294.6 4565.0 0.1%
pet - imp mana
initial_mana none 1.0 74771.7 74771.7 0.0%
mana_feed mana 0.8 88.0 107.7 99.3%
mana_spring_totem mana 1808.8 8451.5 4.7 71.3%
mp5_regen mana 1808.8 170841.4 94.4 65.2%
replenishment mana 1808.8 10144.5 5.6 71.3%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 33.7 17.4 13.5sec 8.9sec 81% 84%

Database details

  • id:54277
  • cooldown name:buff_backdraft
  • tooltip:Reduced cast time for your Shadow Bolt, Incinerate and Chaos Bolt by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bell_of_enraging_resonance 4.8 0.0 103.8sec 103.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_bell_of_enraging_resonance
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:30.00%
blood_fury_sp 4.3 0.0 120.7sec 120.7sec 14% 14%

Database details

  • id:
  • cooldown name:buff_blood_fury_sp
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 10%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
casting 204.6 0.0 2.2sec 2.2sec 60% 60%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
darkmoon_card_volcano 10.3 0.0 46.0sec 46.0sec 27% 27%

Database details

  • id:
  • cooldown name:buff_darkmoon_card_volcano
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:30.00%
demon_soul_imp 4.3 0.0 120.7sec 120.7sec 19% 17%

Database details

  • id:79459
  • cooldown name:buff_demon_soul_imp
  • tooltip:Critical strike chance of your cast time Destruction spells increased by $s1%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
empowered_imp 11.4 0.4 36.1sec 34.9sec 5% 7%

Database details

  • id:47283
  • cooldown name:buff_empowered_imp
  • tooltip:Soulfire is instant cast.
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:4.00%
improved_soul_fire 7.3 31.1 61.0sec 11.6sec 95% 94%

Database details

  • id:85383
  • cooldown name:buff_improved_soul_fire
  • tooltip:Shadow and Fire damage increased by $w1%.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
power_torrent_mh 10.1 0.0 46.6sec 46.6sec 26% 27%

Database details

  • id:
  • cooldown name:buff_power_torrent_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:45.00
  • default_chance:20.00%
soulburn 3.0 0.0 45.7sec 45.7sec 0% 2%

Database details

  • id:74434
  • cooldown name:buff_soulburn
  • tooltip:Secondary effects of some of your spells have been unlocked: Drain Life Summon Imp, Voidwalker, Succubus, Felhunter, Felguard Demonic Circle: Teleport Soul Fire Healthstone Searing Pain
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:100.00%
tier11_4pc_caster 3.8 0.2 86.4sec 81.0sec 6% 100%

Database details

  • id:89937
  • cooldown name:buff_tier11_4pc_caster
  • tooltip:Your next 2 Fel Flame spells deal $89937s1% increased damage.
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:2.00%
volcanic_potion 2.0 0.0 363.2sec 363.2sec 10% 10%

Database details

  • id:
  • cooldown name:buff_volcanic_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
imp-bloodlust 1.0 0.0 0.0sec 0.2sec 9% 9%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
imp-casting 301.0 0.0 1.5sec 1.5sec 95% 95%

Database details

  • id:
  • cooldown name:buff_casting
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent

Database details

  • id:85767
  • cooldown name:buff_dark_intent
  • tooltip:Haste increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
dark_intent_feedback

Database details

  • id:85759
  • cooldown name:buff_dark_intent_feedback
  • tooltip:Periodic damage and healing increased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
fel_armor

Database details

  • id:28176
  • cooldown name:buff_fel_armor
  • tooltip:Increases spell power by $s1 causes you to be healed for $w2% of any single-target spell damage you deal.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
backdraft_0 15.4%
backdraft_1 21.8%
backdraft_2 29.7%
backdraft_3 33.1%

Procs

Count Interval
ebon_imp 5.8 63.5sec
empowered_imp 11.7 34.9sec

Statistics & Data Analysis

DPS
Population
Convergence 67.58%
σ of the average dps 4.6695
2 * σ / μ 0.0339%
95% Confidence Intervall ( μ ± 2σ ) ( 27518.25 - 27536.93 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.97% - 100.03% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27513.58 - 27541.60 )
Sample Data
σ 466.9522
Minimum 25615.17
Maximum 29807.02
Spread ( max - min ) 4191.85
Range ( max - min ) / 2 2095.93
Range% 7.61
10th Percentile 26826.31
90th Percentile 27962.36
( 90th Percentile - 10th Percentile ) 1136.05
Approx. Iterations needed for
1% dps error 11
0.1% dps error 1150
0.1 scale factor error with delta=300 1938
0.05 scale factor error with delta=300 7752
0.01 scale factor error with delta=300 193817
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=draconic_mind
1 food,type=seafood_magnifique_feast
2 fel_armor
3 summon_imp
4 dark_intent
5 snapshot_stats
6 blood_fury
7 volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
8 demon_soul
9 soulburn,if=buff.bloodlust.down
A soul_fire,if=buff.soulburn.up
B fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
C immolate,if=(remains<cast_time+gcd|!ticking)&target.time_to_die>=4&miss_react
D conflagrate
E bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
F corruption,if=(!ticking|dot.corruption.remains<tick_time)&miss_react
G shadowflame
H soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
I chaos_bolt
J summon_doomguard
K soulburn,if=buff.bloodlust.down
L soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
M shadowburn
N incinerate
O life_tap,moving=1,if=mana_pct<80&mana_pct<target.health_pct
P fel_flame,moving=1
Q life_tap

Sample Sequence

01234678CDEFGIJLNDNNNCNGNDFILNNNDCGNNNNIDLF9ANCGDNNILNDFGNCNNDEILNGDNFCNNIDLGN9AADNNCFINDGNLNNNDCINFGHDNNNNN68DCEGIL9ADFNHNHCDGINNNLDFNGNCIDNLNNNDFGICNLDNNNNGIDCEFLNDGNNINNCDFLGNNDINNNCLDFGNINNDNLCGNDH68FINNDEGCLNDINNFNGDLCQINDNNGBFHDBINNNGDLCNNFDHIGNHNDNCENNGDFILNNDNCGNNIDLFNNGDCHNINNDNGFLNCDIN68NNGLDNEFCINDGLNNNDNICFGLDNNNNIDGCLFNDHNNIGNDBBLFNDGCEI7MNDLNGNFDCINMLDGNNNNICDFLGMNDNNINCL68DFGMNNIDELCNGDFMNINLDNCGNNNDFILMGDCNNNNIDLFG

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 667 86 20
Agility 669 88 20
Stamina 8208 6470 5950
Intellect 5730 5048 4639
Spirit 197 197 20
Health 152668 128504 0
Mana 105623 95993 0
Spell Power 9422 7245 2207
Spell Hit 15.47% 15.47% 1585
Spell Crit 20.66% 14.61% 919
Spell Haste 30.05% 20.25% 2593
Spell Penetration 0 0 0
Mana Per 5 1027 1027 0
Attack Power 1435 142 0
Melee Hit 13.20% 13.20% 1585
Melee Crit 16.14% 8.19% 919
Melee Haste 20.25% 20.25% 2593
Expertise 0.00 0.00 0
Armor 12555 8479 8479
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 4.23% 2.32% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 12.97% 12.97% 891

Gear

Encoded
head crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
shirt empty
chest shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1 signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2 planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1 bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2 darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
tabard empty

Talents

Affliction Rank
Doom and Gloom 0
Improved Life Tap 0
Improved Corruption 3
Jinx 0
Soul Siphon 0
Siphon Life 0
Curse of Exhaustion 0
Improved Fear 0
Eradication 0
Improved Howl of Terror 0
Soul Swap 0
Shadow Embrace 0
Death's Embrace 0
Nightfall 0
Soulburn: Seed of Corruption 0
Everlasting Affliction 0
Pandemic 0
Haunt 0
Demonology Rank
Demonic Embrace 2
Dark Arts 3
Fel Synergy 0
Demonic Rebirth 0
Mana Feed 2
Demonic Aegis 0
Master Summoner 0
Impending Doom 0
Demonic Empowerment 0
Improved Health Funnel 0
Molten Core 0
Hand of Gul'dan 0
Aura of Foreboding 0
Ancient Grimoire 0
Inferno 0
Decimation 0
Cremation 0
Demonic Pact 0
Metamorphosis 0
Destruction Rank
Bane 3
Shadow and Flame 3
Improved Immolate 2
Aftermath 0
Emberstorm 2
Improved Searing Pain 0
Improved Soul Fire 2
Backdraft 3
Shadowburn 1
Burning Embers 2
Soul Leech 2
Backlash 0
Nether Ward 1
Fire and Brimstone 3
Shadowfury 1
Nether Protection 2
Empowered Imp 2
Bane of Havoc 1
Chaos Bolt 1

Profile

#!./simc

warlock=Warlock_Destruction_T11_372_PTR
origin="http://chardev.org/?profile=36761"
level=85
race=orc
role=spell
use_pre_potion=1
professions=enchanting=525/inscription=525
talents=http://www.wowhead.com/talent#warlock-00300000000000000023002000000000000003320202312201312211
glyphs=life_tap/immolate/imp/conflagrate
actions=flask,type=draconic_mind
actions+=/food,type=seafood_magnifique_feast
actions+=/fel_armor
actions+=/summon_imp
actions+=/dark_intent
actions+=/snapshot_stats
actions+=/blood_fury
actions+=/volcanic_potion,if=buff.bloodlust.react|!in_combat|target.health_pct<=20
actions+=/demon_soul
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.soulburn.up
actions+=/fel_flame,if=buff.tier11_4pc_caster.react&dot.immolate.remains<8
actions+=/immolate,if=(remains=4&miss_react
actions+=/conflagrate
actions+=/bane_of_doom,if=!ticking&target.time_to_die>=15&miss_react
actions+=/corruption,if=(!ticking|dot.corruption.remains actions+=/shadowflame
actions+=/soul_fire,if=buff.empowered_imp.react&buff.empowered_imp.remains<(buff.improved_soul_fire.remains+action.soul_fire.travel_time)
actions+=/chaos_bolt
actions+=/summon_doomguard
actions+=/soulburn,if=buff.bloodlust.down
actions+=/soul_fire,if=buff.improved_soul_fire.remains<(cast_time+travel_time+action.incinerate.cast_time+gcd)&!in_flight
actions+=/shadowburn
actions+=/incinerate
actions+=/life_tap,moving=1,if=mana_pct<80&mana_pct actions+=/fel_flame,moving=1
actions+=/life_tap
head=crown_of_the_twilight_queen,heroic=1,type=cloth,ilevel=379,quality=epic,stats=1136armor_264crit_244haste_351int_617sta,reforge=crit_hit,gems=burning_shadowspirit_20hit_20int_30int,enchant=60int_35crit
neck=valionas_medallion,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit
shoulders=shadowflame_mantle,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1009armor_191haste_171hit_266int_429sta,gems=40int_10haste,enchant=130int_25haste
chest=shadowflame_robes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1346armor_247crit_227haste_345int_578sta,reforge=crit_hit,gems=40int_20hit_20int_20int,enchant=20all
waist=belt_of_arcane_storms,heroic=1,type=cloth,ilevel=372,quality=epic,stats=757armor_171crit_191haste_266int_429sta,reforge=crit_hit,gems=20haste_20int_40int_10haste
legs=shadowflame_leggings,heroic=1,type=cloth,ilevel=372,quality=epic,stats=1177armor_257haste_217hit_345int_578sta,gems=20haste_20int_40int_20int,enchant=95int_80sta
feet=einhorns_galoshes,heroic=1,type=cloth,ilevel=372,quality=epic,stats=925armor_191haste_266int_171mastery_429sta,reforge=mastery_hit,gems=40int_10haste,enchant=50hit
wrists=bracers_of_the_bronze_flight,heroic=1,type=cloth,ilevel=372,quality=epic,stats=589armor_143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=50int
hands=shadowflame_handwraps,heroic=1,type=cloth,ilevel=372,quality=epic,stats=841armor_171crit_266int_191mastery_429sta,reforge=crit_hit,gems=20haste_20int_10mastery,enchant=50haste
finger1=signet_of_the_fifth_circle,heroic=1,ilevel=372,quality=epic,stats=143haste_215int_143mastery_322sta,reforge=mastery_hit,enchant=40int
finger2=planetary_band_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=321sta_214int_143hit_143crit,reforge=crit_haste,enchant=40int,suffix=129
trinket1=bell_of_enraging_resonance,heroic=1,ilevel=372,quality=epic,stats=363crit,reforge=crit_haste,equip=onspellcast_2178sp_30%_20dur_100cd
trinket2=darkmoon_card_volcano,ilevel=359,quality=epic,stats=321mastery,reforge=mastery_haste,equip=onspelldamage_1200+10fire_1600int_30%_12dur_45cd
back=shroud_of_endless_grief,heroic=1,ilevel=379,quality=epic,stats=699armor_133haste_209int_153mastery_344sta,reforge=mastery_hit,gems=20haste_20int_10int,enchant=50int
main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,ilevel=372,quality=epic,stats=2207sp_247sta_165int_110hit_110crit,reforge=crit_haste,enchant=power_torrent,weapon=sword_1.60speed_73min_137max,suffix=129
off_hand=book_of_binding_will,heroic=1,ilevel=372,quality=epic,stats=143haste_143hit_215int_322sta,enchant=40int
ranged=theresas_booklight,ilevel=359,quality=epic,stats=72hit_107int_72mastery_161sta,reforge=mastery_haste
# Gear Summary # gear_strength=20
# gear_agility=20
# gear_stamina=5950
# gear_intellect=4639
# gear_spirit=20
# gear_spell_power=2207
# gear_hit_rating=1585
# gear_crit_rating=919
# gear_haste_rating=2593
# gear_mastery_rating=891
# gear_armor=8479
# meta_gem=burning_shadowspirit
# tier11_2pc_caster=1
# tier11_4pc_caster=1
# main_hand=stormwake_the_tempests_reach_of_the_wildfire,heroic=1,weapon=sword_1.60speed_73min_137max,enchant=power_torrent

Warrior_Arms_T11_372 : 27726dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27725.8 16.32 / 0.06% 2772.6 10.0 10.1 rage 10.28% 48.7
Origin http://chardev.org/?profile=36399
Talents http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
Glyphs
  • thunder_clap
  • cleaving
  • sweeping_strikes
  • battle
  • berserker_rage
  • intimidating_shout
  • slam
  • overpower
  • mortal_strike

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:31709|24551|17863|15068|8947|3256&chds=0,63417&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++31709++overpower,C79C6E,0,0,15|t++24551++execute,C79C6E,1,0,15|t++17863++mortal_strike,C79C6E,2,0,15|t++15068++slam,C79C6E,3,0,15|t++8947++colossus_smash,C79C6E,4,0,15|t++3256++melee_main_hand,C79C6E,5,0,15&chtt=Warrior_Arms_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:21,19,10,10,10,8,8,5,5,4&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E&chl=overpower|mortal_strike|slam_mh|opportunity_strike|melee_main_hand|deep_wounds|execute|rend_dot|heroic_strike|colossus_smash&chtt=Warrior_Arms_T11_372+Damage+Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:bgbhbhmq4467875uqjljcaZZYWXYYXUXaZYWXaZYWYZWUTSTSQRRQPPQQPQPQVWXYWXZXXXVVVUVTTSTTSRSQRSQQQPRSRRQPRRPQPPPQPPOPPQQPOOPQPPPPQSSUWXbegjnqtuurpmljhedcbbaYYYXXXXXWWVVUTTUTTTRRSSRRQQRQQQPPRRRRSRSSRSSQRSQRRQQRQQQQQRRRRRRSSSTTTTTSSSSTTSSSSSSRRRRRRRQQRRRRSUVWYacgikmmmlkjhgedcbaZXXXXWWVVWWVVUTUUTUTTTTTTTSTTSSSRSSRRSSTUUUUUUUTSSRRSRQRQQRQQQQQRRQRRSSSRSSSSSSSSSSSSSSSSSSSSSSRSSSTTTUUVWXXYZZaZZYZYYXWWXWWWVVVVVVUUVUUUTTTTTTSSTTTSSSSSSSRRSSSSSSTTSSRRSSSSRSSSSSSSTTS&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=96&chtt=Warrior_Arms_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:355555775556687775123ywvvvurqrqqqpoonoonllllljiiiihgffffffeeefffeeffffeeffgffeffffeeeffeeeeffeeeefffeeffggffgghggghijjjjklmllmmoonnnoooonnnnnmllmmmlkkllllkkkllkkjkkkjihiihhgfgggfeefffeeeeffeeeeffeeeeffeeeeffffffggggghhihhhiijihhiiiihhhiiihhiijiiijjkjjjkllkkkkllkkjkkkkjjkkkkjjkkkkjjkkkkjijjjihhhiihhhhiihhhiijiiijjkkjjkklkkklllllllmmmmmmnnnmmmnnnmmmmnmmmmmmmmmmmmmmmmnnnnnnnooooooopopppqqqqrrssssttuuuuvvvvvvvvvvuuuttttttttttttttuuuuuvvvvvvvvvwvvwwwwvv&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27726|max=43790&chxp=1,1,63,100&chtt=Warrior_Arms_T11_372+DPS+Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,0,1,1,6,3,7,22,30,60,64,100,122,213,246,340,372,446,534,573,636,601,647,694,658,545,553,470,459,365,293,249,181,151,113,80,45,42,24,19,13,7,5,4,4,0,0,0,0,1&chds=0,694&chbh=5&chxt=x&chxl=0:|min=24603|avg=27726|max=31408&chxp=0,1,46,100&chtt=Warrior_Arms_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Arms_T11_372 27726
battle_shout 0 0.0% 5.8 70.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
5.82 5.82 0.00 0.00 1.5154 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 5.8 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 15.2 30.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
15.16 15.16 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 15.2 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
colossus_smash 1099 4.0% 36.6 12.38sec 13556 8947 11244 23736 41628 21.5% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.64 36.64 0.00 0.00 1.5151 0.0000 496738
Direct Results Count Pct Average Min Max Total Damage
hit 27.6 75.23% 11244.30 8955 19884 309970
crit 7.9 21.47% 23736.11 18546 41628 186768
dodge 1.2 3.30% 0.00 0 0 0

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
deadly_calm 0 0.0% 3.5 127.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.53 3.53 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.5 100.00% 0.00 0 0 0

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:energy
  • tree:Unknown
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:-0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Abilities cost no rage.
  • description:For the next $d, none of your abilities cost rage, but you continue to generate rage. Cannot be used during Inner Rage.
deep_wounds 2255 8.1% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 432 2359 0 0.0% 0.0% 95.6%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 173.70 432.02 432.02 0.0000 1.0000 1019265
Direct Results Count Pct Average Min Max Total Damage
hit 173.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 432.0 100.00% 2359.31 770 9499 1019265

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:979.11
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 2092 7.5% 25.5 3.48sec 37088 24551 30686 57889 142168 27.3% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
25.50 25.50 0.00 0.00 1.5106 0.0000 945805
Direct Results Count Pct Average Min Max Total Damage
hit 17.7 69.38% 30686.30 651 65877 542933
crit 7.0 27.29% 57888.89 1078 142168 402872
dodge 0.8 3.33% 0.00 0 0 0

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.815733
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 1404 5.1% 36.5 12.08sec 17401 0 12632 27442 50061 35.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
36.46 36.46 0.00 0.00 0.0000 0.0000 634479
Direct Results Count Pct Average Min Max Total Damage
hit 22.5 61.70% 12631.58 8369 23197 284182
crit 12.8 35.01% 27441.57 17409 50061 350297
dodge 1.2 3.29% 0.00 0 0 0

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 2705 9.8% 125.1 3.64sec 9778 3256 8865 18251 31201 18.5% 3.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
125.06 125.06 0.00 0.00 3.0026 0.0000 1222832
Direct Results Count Pct Average Min Max Total Damage
hit 67.7 54.14% 8865.14 6352 15146 600276
crit 23.2 18.53% 18251.26 13162 31201 422852
glance 30.0 24.01% 6651.43 4764 11360 199703
dodge 4.2 3.33% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 5343 19.3% 88.8 5.10sec 27205 17863 20079 45780 78294 30.3% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
88.77 88.77 0.00 0.00 1.5229 0.0000 2415097
Direct Results Count Pct Average Min Max Total Damage
hit 58.9 66.39% 20079.32 12272 32894 1183411
crit 26.9 30.31% 45779.77 27881 78294 1231686
dodge 2.9 3.30% 0.00 0 0 0

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:Healing effects received reduced by $s1%.
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and wounds the target, reducing the effectiveness of any healing received by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:423.09
  • base_dd_max:423.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
opportunity_strike 2739 9.9% 128.8 3.50sec 9611 0 7996 16873 28223 21.2% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
128.81 128.81 0.00 0.00 0.0000 0.0000 1238070
Direct Results Count Pct Average Min Max Total Damage
hit 97.2 75.49% 7996.23 5854 13700 777591
crit 27.3 21.19% 16872.97 12126 28223 460479
dodge 4.3 3.32% 0.00 0 0 0

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:mana
  • tree:Unknown
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
overpower 5815 21.0% 81.6 5.48sec 32214 31709 15926 36524 58716 79.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
81.60 81.60 0.00 0.00 1.0159 0.0000 2628552
Direct Results Count Pct Average Min Max Total Damage
hit 17.1 20.92% 15926.45 8785 25843 271892
crit 64.5 79.08% 36523.73 19960 58716 2356661

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • base_cost:5.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.60
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly overpower the enemy, causing $m1% weapon damage. Only useable after the target dodges. The Overpower cannot be blocked, dodged or parried.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
recklessness 0 0.0% 2.0 363.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.00 2.00 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.0 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
rend 1482 5.3% 1.2 211.32sec 567804 372056 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: rend

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.18 1.18 0.00 0.00 1.5261 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 1.2 100.00% 0.00 0 0 0

Action details: rend

Static Values
  • id:772
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Wounds the target causing them to bleed for $94009o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $94009d.
rend_dot 1482 5.3% 1.2 211.32sec 567804 0 0 0 0 0.0% 3.3% 0.0% 0.0% 150 3654 7555 21.1% 0.0% 98.6%

Stats details: rend_dot

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
1.18 1.18 149.66 149.66 0.0000 2.9771 670066
Direct Results Count Pct Average Min Max Total Damage
hit 1.1 96.65% 0.00 0 0 0
dodge 0.0 3.35% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 118.1 78.89% 3654.03 1358 5136 431440
crit 31.6 21.11% 7554.85 2798 10580 238625

Action details: rend_dot

Static Values
  • id:94009
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:Wounds the target causing them to bleed for $o1 damage plus an additional ${0.25*6*(($MWB+$mwb)/2+$AP/14*$MWS)} (based on weapon damage) over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:2540.26
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
slam 2793 10.1% 55.4 6.41sec 22811 15068 0 0 0 0.0% 3.3% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.35 55.35 0.00 0.00 1.5138 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 53.5 96.65% 0.00 0 0 0
dodge 1.9 3.35% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 2793 10.1% 53.5 6.63sec 23601 0 18043 41074 67787 24.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
53.50 53.50 0.00 0.00 0.0000 0.0000 1262569
Direct Results Count Pct Average Min Max Total Damage
hit 40.6 75.87% 18043.50 10963 29836 732341
crit 12.9 24.13% 41074.29 24909 67787 530228

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Arms_T11_372
colossus_smash rage 14.7% 745.5 18
execute rage 14.5% 1441.9 26
heroic_strike rage 8.8% 1599.6 11
mortal_strike rage 36.0% 1484.4 18
overpower rage 8.3% 7003.5 5
rend rage 0.0% 488030.4 1
slam rage 16.8% 1658.6 14
Resource Gains Type Count rage Average Overflow
anger_management rage 1808.8 147.7 0.1 2.0%
avoided_attacks rage 5.9 91.6 15.4 0.0%
battle_shout rage 5.8 116.5 20.0 0.0%
berserker_rage rage 15.2 75.8 5.0 0.0%
blood_frenzy rage 12.1 230.7 19.1 4.7%
melee_main_hand rage 125.1 3779.2 30.2 2.1%
sudden_death rage 12.9 109.2 8.4 0.0%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 3.0 0.0 183.6sec 362.5sec 99% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 12.9 0.0 32.4sec 32.4sec 5% 7%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 15.2 0.0 30.8sec 30.8sec 33% 33%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance 2.0 0.0 365.3sec 365.3sec 1% 100%

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.3sec 123.3sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
colossus_smash 29.0 6.4 15.7sec 12.8sec 46% 40%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
deadly_calm 3.5 0.0 127.3sec 127.3sec 8% 6%

Database details

  • id:
  • cooldown name:buff_deadly_calm
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
executioner_talent 1.5 23.2 45.7sec 3.6sec 19% 41%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 338.6sec 338.6sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.6 0.0 107.2sec 107.2sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 3.2 0.0 106.2sec 106.2sec 2% 9%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
inner_rage 4.0 0.0 104.9sec 104.9sec 13% 13%

Database details

  • id:1134
  • cooldown name:buff_inner_rage
  • tooltip:Heroic Strike and Cleave cooldown reduced.
  • max_stacks:1
  • duration:15.00
  • cooldown:30.00
  • default_chance:100.00%
lambs_to_the_slaughter 1.1 84.8 246.4sec 5.3sec 100% 100%

Database details

  • id:
  • cooldown name:buff_lambs_to_the_slaughter
  • tooltip:(null)
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
landslide_mh 14.3 24.8 31.9sec 11.4sec 65% 66%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
overpower 14.1 0.4 30.8sec 30.0sec 4% 16%

Database details

  • id:
  • cooldown name:buff_overpower
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:1.00
  • default_chance:100.00%
recklessness 2.0 0.0 363.7sec 363.7sec 5% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
taste_for_blood 73.5 1.5 6.1sec 6.0sec 22% 90%

Database details

  • id:
  • cooldown name:buff_taste_for_blood
  • tooltip:(null)
  • max_stacks:1
  • duration:9.00
  • cooldown:5.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 80.6 374.7sec 5.5sec 98% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
wrecking_crew 13.7 13.2 33.6sec 16.7sec 55% 55%

Database details

  • id:
  • cooldown name:buff_wrecking_crew
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 2.0%

Procs

Count Interval
munched_deep_wounds 31.1 14.7sec
rolled_deep_wounds 30.9 15.3sec
strikes_of_opportunity 128.8 3.5sec
sudden_death 33.8 13.3sec

Statistics & Data Analysis

DPS
Population
Convergence 70.38%
σ of the average dps 8.1622
2 * σ / μ 0.0589%
95% Confidence Intervall ( μ ± 2σ ) ( 27709.46 - 27742.11 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27701.30 - 27750.27 )
Sample Data
σ 816.2197
Minimum 24603.45
Maximum 31407.88
Spread ( max - min ) 6804.43
Range ( max - min ) / 2 3402.21
Range% 12.27
10th Percentile 26695.05
90th Percentile 28788.34
( 90th Percentile - 10th Percentile ) 2093.30
Approx. Iterations needed for
1% dps error 34
0.1% dps error 3466
0.1 scale factor error with delta=300 5921
0.05 scale factor error with delta=300 23687
0.01 scale factor error with delta=300 592190
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
6 stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
7 recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
8 berserker_rage,if=!buff.deadly_calm.up&rage<70
9 deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
A sweeping_strikes,if=target.adds>0
B bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
C cleave,if=target.adds>0
D inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
E heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
F overpower,if=buff.taste_for_blood.remains<=1.5
G mortal_strike,if=target.health_pct>20|rage>=30
H execute,if=buff.battle_trance.up
I rend,if=!ticking
J colossus_smash,if=buff.colossus_smash.remains<0.5
K execute,if=(buff.deadly_calm.up|buff.recklessness.up)
L mortal_strike
M overpower
N execute
O slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
P battle_shout,if=rage<20

Sample Sequence

013458P7GJ69EIGEMOEGMODEGDEMODEGOMJGOOM8GJOGEMJFGEMDOEGOMGOMGEOJG8EMPGMOGMGOEFMGJOGEMJGMO8GOMGOMGOGEMJGMJGMOG8O9EMGOEGEMODJDEGMOJGMOPGJEJG8MMFGEFJMGOJMGOJGEMOMGO8MGOJMGEOMGOJMGOMGOPE8GMOGEMJGOMGMGOMGOJG89EMOEFGMEOGDEJMEGOMJGEOMEPG8MEFGEJMGOMGOMGOGMOJFGJ8MEGMJGOMJGOOGMGMOGFMG8JOGEMJEGMOGEMGOMGOJGMO89EMGOEGEMODEGOMJGOMGFOMG8EGMOPGJMGEOJMGOMGOGMJG8MOF57K6KGEKKKGKJGMNMGNJN8GMNNGJMNLMNJLMNJLMNNNG8EMNNLEMPJGEMNNNGMNNGJMNGJ8MNGJMNLEJMNNGMNN

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6261 4977 4548
Agility 729 145 20
Stamina 7658 6035 5862
Intellect 55 53 20
Spirit 82 82 20
Health 150167 127515 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 9.59% 9.59% 982
Spell Crit 20.36% 15.36% 2575
Spell Haste 11.23% 5.93% 760
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14215 10354 190
Melee Hit 8.18% 8.18% 982
Melee Crit 23.36% 15.96% 2575
Melee Haste 5.93% 5.93% 760
Expertise 12.69 12.69 381
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 15.02% 15.02% 1259

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand empty
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 2
Taste for Blood 3
Sweeping Strikes 1
Impale 2
Improved Hamstring 0
Improved Slam 2
Deadly Calm 1
Blood Frenzy 2
Lambs to the Slaughter 3
Juggernaut 1
Sudden Death 2
Wrecking Crew 2
Throwdown 1
Bladestorm 1
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 0
Rude Interruption 0
Piercing Howl 0
Flurry 0
Death Wish 0
Enrage 0
Die by the Sword 0
Raging Blow 0
Rampage 0
Heroic Fury 0
Furious Attacks 0
Meat Cleaver 0
Intensify Rage 0
Bloodsurge 0
Skirmisher 0
Titan's Grip 0
Single-Minded Fury 0
Protection Rank
Incite 1
Toughness 0
Blood and Thunder 2
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Arms_T11_372
origin="http://chardev.org/?profile=36399"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200032312021231221103220000000000000000010200000000000000000
glyphs=thunder_clap/cleaving/sweeping_strikes/battle/berserker_rage/intimidating_shout/slam/overpower/mortal_strike
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker,if=cooldown.recklessness.remains=0&rage<=50&((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/stance,choose=battle,if=(cooldown.recklessness.remains>0&rage<=50)
actions+=/recklessness,if=((target.health_pct>20&target.time_to_die>320)|target.health_pct<=20)
actions+=/berserker_rage,if=!buff.deadly_calm.up&rage<70
actions+=/deadly_calm,if=rage<30&((target.health_pct>20&target.time_to_die>130)|(target.health_pct<=20&buff.recklessness.up))
actions+=/sweeping_strikes,if=target.adds>0
actions+=/bladestorm,if=target.adds>0&!buff.deadly_calm.up&!buff.sweeping_strikes.up
actions+=/cleave,if=target.adds>0
actions+=/inner_rage,if=!buff.deadly_calm.up&rage>80&cooldown.deadly_calm.remains>15
actions+=/heroic_strike,if=(rage>70|buff.deadly_calm.up|buff.incite.up|buff.battle_trance.up)
actions+=/overpower,if=buff.taste_for_blood.remains<=1.5
actions+=/mortal_strike,if=target.health_pct>20|rage>=30
actions+=/execute,if=buff.battle_trance.up
actions+=/rend,if=!ticking
actions+=/colossus_smash,if=buff.colossus_smash.remains<0.5
actions+=/execute,if=(buff.deadly_calm.up|buff.recklessness.up)
actions+=/mortal_strike
actions+=/overpower
actions+=/execute
actions+=/slam,if=(cooldown.mortal_strike.remains>=1.5&(rage>=35|swing.mh.remains<1.1|buff.deadly_calm.up|buff.colossus_smash.up))|(cooldown.mortal_strike.remains>=1.2&buff.colossus_smash.remains>0.5&rage>=35)
actions+=/battle_shout,if=rage<20
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_hit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=treads_of_savage_beatings,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_191crit_171haste_429sta_266str,reforge=haste_mastery,gems=20crit_20str_10crit,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_67str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_67str_10str,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_hit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4548
# gear_agility=20
# gear_stamina=5862
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=381
# gear_hit_rating=982
# gear_crit_rating=2575
# gear_haste_rating=760
# gear_mastery_rating=1259
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_1h_T11_372 : 28210dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
28209.8 17.41 / 0.06% 2235.7 12.6 12.7 rage 8.52% 46.0
Origin http://chardev.org/?profile=36557
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • battle
  • berserker_rage
  • bloody_healing
  • slam
  • raging_blow
  • bloodthirst

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:24042|20339|16468|13290|7039|5145|3199&chds=0,48084&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++24042++execute,C79C6E,0,0,15|t++20339++bloodthirst,C79C6E,1,0,15|t++16468++slam,C79C6E,2,0,15|t++13290++raging_blow,C79C6E,3,0,15|t++7039++colossus_smash,C79C6E,4,0,15|t++5145++melee_main_hand,C79C6E,5,0,15|t++3199++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_1h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x310&cht=p&chf=bg,s,333333&chd=t:33,18,11,10,6,6,5,4,3,3,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|melee_off_hand|heroic_strike|deep_wounds|execute|slam_mh|raging_blow_mh|slam_oh|raging_blow_oh|colossus_smash&chtt=Warrior_Fury_1h_T11_372+Damage+Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:cqpYafZenjosquzwz1z1312vpmmkjnx145667767643zsleeeafggjlknonpsruwrojbeebhkknporsrtutuurohbcbZdghkmmoqqsuuvvtpjedccegikmnopqqssttsoiecccehklnoprssronpokgdaaabeghjllnoprsssrnjfcccdgjkmnoqqrstttspkgdddegikmnoqqsstutsplgdccdfiklnoprsttutsplheccdfikmnpqrstuutsplheddefijlmnpqrstttsplheddefhjlmnomklmnonlifcbabdegijklmnopppomjgedcdegijklmnopqrrqomjgfeefhiklmnoppqqqqpmkigffghjklmnooppqqpomkigfffgijklmnnoppppomljhhgghijklmnnooppponmkjihhiijjhhijkklmmnmmlkjjkk&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=69&chtt=Warrior_Fury_1h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:74652331220223111zzzwvvuuutssrrrqppommkjjihhgfffeedccbbbaaaaaaaaaaaaaaaaababbabaaaaaaaaaaaaaaaaabbbbbcccdddeeeefffgggggggfffffeeeeddddddddddeeffgghhiijjkkkllllllkkkjiihhggffeeddcccbbbaaaaaaaaaaaaaaabbbbbbccccdddeeeefffffffggffffffffffffggggggggggggggfffeeedddccccccccddeeeffffggggghhhhhgggggggffffffffffffgggggggggghhhhhhhhhhhhhggggggggffffffeeeeeeedddddddddddddccccccccccccccccdddddddeeeefffgghhiiijjjkkkkkkkkkjjjjjjjjjjjjjjjkkklllllmmmmmmmnnnnnoooopp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=28210|max=51423&chxp=1,1,55,100&chtt=Warrior_Fury_1h_T11_372+DPS+Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:1,3,1,6,4,7,12,20,36,40,61,88,120,150,186,218,281,329,379,450,491,497,557,553,553,586,612,532,506,486,423,353,327,243,214,174,112,95,88,57,43,32,29,17,6,8,4,5,3,2&chds=0,612&chbh=5&chxt=x&chxl=0:|min=25035|avg=28210|max=31431&chxp=0,1,50,100&chtt=Warrior_Fury_1h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T11_372 28210
battle_shout 0 0.0% 12.2 36.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.25 12.25 0.00 0.00 1.5150 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.2 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 6.9 55.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
6.90 6.90 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 6.9 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 9200 32.6% 134.8 3.34sec 30862 20339 22667 47238 101622 33.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
134.76 134.76 0.00 0.00 1.5174 0.0000 4159153
Direct Results Count Pct Average Min Max Total Damage
hit 89.8 66.65% 22667.23 14404 49331 2035909
crit 44.9 33.35% 47238.29 29672 101622 2123243

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 515 1.8% 21.9 21.10sec 10645 7039 8480 17657 26651 23.6% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.88 21.88 0.00 0.00 1.5124 0.0000 232867
Direct Results Count Pct Average Min Max Total Damage
hit 16.7 76.40% 8479.58 6477 12938 141718
crit 5.2 23.60% 17657.09 13343 26651 91149

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage dealt by $w1%.$?$w3!=0[ Increases all damage taken by $w3%.][]
  • description:When activated you become Enraged, increasing your physical damage by $s1%$?s94374[][but increasing all damage taken by $s3%]. Lasts $d.
deep_wounds 1612 5.7% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 433 1682 0 0.0% 0.0% 95.8%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 209.74 433.32 433.32 0.0000 1.0000 728811
Direct Results Count Pct Average Min Max Total Damage
hit 209.7 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 433.3 100.00% 1681.93 302 6999 728811

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1494.10
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1565 5.5% 19.5 4.59sec 36324 24042 29468 60268 129276 22.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
19.48 19.48 0.00 0.00 1.5108 0.0000 707644
Direct Results Count Pct Average Min Max Total Damage
hit 15.1 77.74% 29467.59 4483 62755 446296
crit 4.3 22.26% 60268.45 15175 129276 261348

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2777 9.8% 55.3 8.00sec 22722 0 15485 31855 66283 44.2% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
55.26 55.26 0.00 0.00 0.0000 0.0000 1255520
Direct Results Count Pct Average Min Max Total Damage
hit 30.8 55.79% 15485.12 9399 32176 477389
crit 24.4 44.21% 31854.71 19362 66283 778131

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 5139 18.2% 261.9 1.73sec 8872 5145 9162 18877 36454 20.4% 18.8% 24.1% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.86 261.86 0.00 0.00 1.7245 0.0000 2323248
Direct Results Count Pct Average Min Max Total Damage
hit 96.4 36.81% 9161.65 6173 17696 883179
crit 53.4 20.37% 18876.78 12715 36454 1007109
glance 63.0 24.06% 6872.13 4629 13272 432961
miss 49.1 18.75% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3195 11.3% 261.2 1.73sec 5530 3199 5712 11763 22784 20.4% 18.8% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
261.21 261.21 0.00 0.00 1.7287 0.0000 1444390
Direct Results Count Pct Average Min Max Total Damage
hit 96.4 36.89% 5711.97 3858 11060 550370
crit 53.2 20.36% 11762.99 7947 22784 625542
glance 62.7 23.99% 4284.55 2893 8295 268478
miss 49.0 18.77% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 2054 7.3% 46.1 9.48sec 20152 13290 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.08 46.08 0.00 0.00 1.5163 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 46.1 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 1262 4.5% 46.1 9.48sec 12380 0 9419 19735 38386 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.08 46.08 0.00 0.00 0.0000 0.0000 570426
Direct Results Count Pct Average Min Max Total Damage
hit 32.9 71.30% 9419.39 6568 18634 309447
crit 13.2 28.70% 19734.81 13530 38386 260979

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 792 2.8% 46.1 9.48sec 7772 0 5911 12393 23991 28.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
46.08 46.08 0.00 0.00 0.0000 0.0000 358115
Direct Results Count Pct Average Min Max Total Damage
hit 32.8 71.29% 5910.81 4105 11646 194145
crit 13.2 28.71% 12393.25 8456 23991 163970

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.34 2.34 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
slam 2153 7.6% 39.1 11.27sec 24883 16468 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.13 39.13 0.00 0.00 1.5110 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 39.1 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1295 4.6% 39.1 11.27sec 14968 0 11484 23809 45621 28.3% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.13 39.13 0.00 0.00 0.0000 0.0000 585657
Direct Results Count Pct Average Min Max Total Damage
hit 28.1 71.73% 11484.36 8113 22146 322324
crit 11.1 28.27% 23809.32 16713 45621 263334

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45
slam_oh 858 3.0% 39.1 11.27sec 9914 0 7599 15738 29660 28.5% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
39.13 39.13 0.00 0.00 0.0000 0.0000 387917
Direct Results Count Pct Average Min Max Total Damage
hit 28.0 71.55% 7598.66 5382 14398 212720
crit 11.1 28.45% 15738.16 11087 29660 175197

Action details: slam_oh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_1h_T11_372
bloodthirst rage 47.2% 1543.1 20
colossus_smash rage 7.5% 541.6 20
death_wish rage 0.5% 0.0 7
execute rage 9.8% 1264.6 29
heroic_strike rage 19.5% 1131.3 20
raging_blow rage 15.5% 1050.4 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.2 367.5 30.0 0.0%
berserker_rage rage 6.9 46.9 6.8 0.2%
melee_main_hand rage 212.8 3558.1 16.7 1.0%
melee_off_hand rage 212.2 1780.8 8.4 0.7%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 20.1 0.0 21.3sec 21.3sec 8% 8%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 6.9 0.0 55.5sec 55.5sec 15% 15%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 4.0 0.0 123.0sec 123.0sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 39.3 1.1 11.3sec 10.9sec 16% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 14.6 41.9 29.2sec 7.4sec 58% 56%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 18.4 47.5sec 4.6sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 77.7 152.0 5.8sec 2.0sec 70% 69%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.5sec 339.5sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 104.8sec 104.8sec 21% 21%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.1 0.0 41.1sec 41.1sec 10% 16%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 13.5 13.1 33.2sec 16.4sec 51% 51%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.6 46.0sec 32.4sec 29% 31%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.7 44.4 367.3sec 9.5sec 96% 95%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.8%

Procs

Count Interval
munched_deep_wounds 47.7 9.7sec
rolled_deep_wounds 35.1 13.1sec

Statistics & Data Analysis

DPS
Population
Convergence 70.64%
σ of the average dps 8.7042
2 * σ / μ 0.0617%
95% Confidence Intervall ( μ ± 2σ ) ( 28192.37 - 28227.18 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.94% - 100.06% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 28183.66 - 28235.89 )
Sample Data
σ 870.4188
Minimum 25035.04
Maximum 31430.88
Spread ( max - min ) 6395.84
Range ( max - min ) / 2 3197.92
Range% 11.34
10th Percentile 27105.19
90th Percentile 29319.72
( 90th Percentile - 10th Percentile ) 2214.53
Approx. Iterations needed for
1% dps error 38
0.1% dps error 3808
0.1 scale factor error with delta=300 6734
0.05 scale factor error with delta=300 26937
0.01 scale factor error with delta=300 673447
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F slam,if=buff.bloodsurge.react
G execute,if=rage>=50
H berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
I raging_blow
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEIEAEIEFEIAEFECAEIAEFEHIEAEIEAFEACEAJEFEIEFEHIEAECEIEAEAFEAJEAFEAIECEAFEIEEHIEFEFECAEIEFAEJAEIEAEFAECAEEHIEEIE7FEIJCEAIEAEIEAEAIEEACEAFEAIEJEAHIEAFEIEACEAIEEEEFECEHIEFEIEFEFEFECAFEAJ6EAFEFAEFAEHIECEIEFEFEIEJAEIAECFEAIEEIE7EFEICEAFEFIEFAEIEJAECAEFAEHIEAEAIEAEFECAEFEAFEFIEAFEHIEAFCAEIAEJEIEEFAEIECAEHIEEFEIAEFEFEACEAFEAFEIJAEFEIEACEAIEEIE7FBDDCDDEAJEIBEGEIECBEHIEGEGIEJ6EBCEAFEABEGEGIEGECFAEBEFEAFBEGEFECABEFEGGEGEI

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6222 4940 4513
Agility 729 145 20
Stamina 7572 5953 5780
Intellect 55 53 20
Spirit 82 82 20
Health 148963 126367 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 6.10% 6.10% 625
Spell Crit 20.20% 15.20% 2545
Spell Haste 13.93% 8.50% 1089
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14130 10280 190
Melee Hit 8.20% 8.20% 625
Melee Crit 23.19% 15.79% 2545
Melee Haste 8.50% 8.50% 1089
Expertise 26.64 26.64 800
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 6.51% 6.51% 809

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 0
Single-Minded Fury 1
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_1h_T11_372
origin="http://chardev.org/?profile=36557"
level=85
race=worgen
role=attack
use_pre_potion=1
professions=blacksmithing=525/jewelcrafting=525
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022320120000000000000000000
glyphs=death_wish/cleaving/heroic_throw/battle/berserker_rage/bloody_healing/slam/raging_blow/bloodthirst
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=haste_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=earthen_pauldrons,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191haste_171hit_429sta_266str,reforge=hit_crit,gems=40str_10haste,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_mastery,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_exp,gems=40str_67str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=mastery_crit,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=40str,enchant=50mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_exp,gems=20crit_20str_67str_10str,enchant=50str
hands=plated_fists_of_provocation,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191crit_171haste_429sta_266str,gems=20crit_20str_67str_10crit,enchant=50str
finger1=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
finger2=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
trinket1=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
trinket2=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,enchant=65crit
main_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
off_hand=lava_spine,heroic=1,ilevel=372,quality=epic,stats=110crit_110haste_248sta_165str,enchant=landslide,weapon=sword_2.60speed_949min_1764max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4513
# gear_agility=20
# gear_stamina=5780
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=800
# gear_hit_rating=625
# gear_crit_rating=2545
# gear_haste_rating=1089
# gear_mastery_rating=809
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket2=fury_of_angerforge
# main_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# off_hand=lava_spine,heroic=1,weapon=sword_2.60speed_949min_1764max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Warrior_Fury_2h_T11_372 : 27917dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
27917.3 18.94 / 0.07% 2203.0 12.7 12.8 rage 8.50% 46.2
Origin http://chardev.org/?profile=36611
Talents http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
Glyphs
  • death_wish
  • cleaving
  • heroic_throw
  • bloody_healing
  • battle
  • berserker_rage
  • bloodthirst
  • raging_blow
  • slam

Charts

http://3.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:21650|20944|18035|12504|9510|4977|3093&chds=0,43300&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++21650++raging_blow,C79C6E,0,0,15|t++20944++execute,C79C6E,1,0,15|t++18035++bloodthirst,C79C6E,2,0,15|t++12504++slam,C79C6E,3,0,15|t++9510++colossus_smash,C79C6E,4,0,15|t++4977++melee_main_hand,C79C6E,5,0,15|t++3093++melee_off_hand,C79C6E,6,0,15&chtt=Warrior_Fury_2h_T11_372+Damage+Per+Execute+Time&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x300&cht=p&chf=bg,s,333333&chd=t:29,18,11,9,9,7,6,5,4,2&chds=0,100&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E&chl=bloodthirst|melee_main_hand|melee_off_hand|raging_blow_mh|heroic_strike|deep_wounds|raging_blow_oh|slam_mh|execute|colossus_smash&chtt=Warrior_Fury_2h_T11_372+Damage+Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:foqbdaXbnimkkpyuvtrx20ytmkcfgow0vx1685zz134xskccZbhhiijkmommoorsnkgYaaahjjlllpqqqpprrplfZYYZdggiijmnoppqrrqmgcaZbehijjkmoooopqqokfbZZadgiijlmoppnjjkkhdZXXZbeffghjlllmmoonjfbYYadgijklmoooopqqolhdbacegijjlmnopppqpokgdaabdfhijlmnoppqqqolhdbabdfhijklnooppqpolhebbcdfhijlmnopppqpnlhecbcdfhijkmmkiijjkjgebZYZacdefgijkkklllkifdbabcegghijlmmnnoomligeddefghikllmnnooonljhfeeefhijklmnnooponmkigeeefghijklmnnooonmkjhgffghijkklmnooooonlkihgghhijihghijkkllllkjiihij&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=71&chtt=Warrior_Fury_2h_T11_372+Rage+Timeline&chts=dddddd,18&chco=C41F3B http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:8453223111z1111zzxxxvttsssrqqppponomkkjiihgggffeddcccbbbaaaZaaZaaZaaZaaZaaZaaZaaZaaaaaaaaaaZaaaaaaaaabbbbcccccdddeeeeeeeeeeeeddddddcccccccccddeeffgghhhiijjkkkkkkkkkjiihhggffeeddcccbbaaaZZZZZZZZZZZZZaaaaaaaabbbbccccccdddddddeeeedddeeeeefffffggggggffffffeeedddccbbbbbbbbcccdddddeeefffffgggggggggggffggfffffffffgfffffffffffffffffeeeeeeeeeeeeeddddddddddcccccccccccbbbbbbbbbbbbbbbbbbbbbbbbccccccdddeeefffgggghhhhhhhhhhggggggggggggghhhhiiijjkkkllllmmmnnnnooo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=27917|max=52839&chxp=1,1,53,100&chtt=Warrior_Fury_2h_T11_372+DPS+Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chd=t:5,1,6,7,15,21,25,40,59,72,109,141,168,236,276,294,367,438,497,499,551,629,605,565,573,552,543,467,430,358,339,276,241,166,129,90,68,37,37,23,18,8,8,4,1,1,2,1,1,1&chds=0,629&chbh=5&chxt=x&chxl=0:|min=24631|avg=27917|max=31816&chxp=0,1,46,100&chtt=Warrior_Fury_2h_T11_372+DPS+Distribution&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Max Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T11_372 27917
battle_shout 0 0.0% 12.1 37.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
12.07 12.07 0.00 0.00 1.5148 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 12.1 100.00% 0.00 0 0 0

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases your Strength and Agility by $w1.
  • description:Increases Strength and Agility of all raid and party members within $a1 yards by $s1, and generates ${$92049m1/10} Rage. Lasts $d.
berserker_rage 0 0.0% 9.5 44.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
9.55 9.55 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 9.5 100.00% 0.00 0 0 0

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Immune to Fear, Sap and Incapacitate effects. Generating extra rage when taking damage.
  • description:Enter a berserker rage, removing and granting immunity to Fear, Sap and Incapacitate effects and generating extra rage when taking damage. Lasts $d.
bloodthirst 7997 28.6% 132.1 3.41sec 27361 18035 19960 41649 89842 34.1% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
132.12 132.12 0.00 0.00 1.5171 0.0000 3614996
Direct Results Count Pct Average Min Max Total Damage
hit 87.0 65.88% 19959.90 12557 43613 1737260
crit 45.1 34.12% 41649.17 26126 89842 1877736

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage. In addition, the next $23885n successful melee attacks will restore ${$m2/1000}.1% of max health. This effect lasts $23885d. Damage is based on your attack power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800300
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 696 2.5% 21.9 21.10sec 14392 9510 11388 23711 35077 24.4% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
21.87 21.87 0.00 0.00 1.5133 0.0000 314709
Direct Results Count Pct Average Min Max Total Damage
hit 16.5 75.63% 11388.34 8692 17028 188340
crit 5.3 24.37% 23710.71 17905 35077 126369

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Defenses weakened, allowing the warrior's attacks to bypass $w2% of their armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $d. Bypasses less armor on players.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:120.00
  • base_dd_max:120.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
death_wish 0 0.0% 3.6 144.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: death_wish

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
3.60 3.60 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 3.6 100.00% 0.00 0 0 0

Action details: death_wish

Static Values
  • id:12292
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:10.0
  • cooldown:144.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Increases physical damage dealt by $w1%.$?$w3!=0[ Increases all damage taken by $w3%.][]
  • description:When activated you become Enraged, increasing your physical damage by $s1%$?s94374[][but increasing all damage taken by $s3%]. Lasts $d.
deep_wounds 2010 7.2% 0.0 0.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 423 2149 0 0.0% 0.0% 93.5%

Stats details: deep_wounds

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
0.00 182.99 422.67 422.67 0.0000 1.0000 908495
Direct Results Count Pct Average Min Max Total Damage
hit 183.0 100.00% 0.00 0 0 0
Tick Results Count Pct Average Min Max Total Damage
hit 422.7 100.00% 2149.42 429 10215 908495

Action details: deep_wounds

Static Values
  • id:12834
  • school:bleed
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:1612.12
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.48
execute 1152 4.1% 16.5 5.45sec 31625 20944 25522 52205 112580 22.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
16.46 16.46 0.00 0.00 1.5099 0.0000 520634
Direct Results Count Pct Average Min Max Total Damage
hit 12.7 77.13% 25521.89 1073 57068 324067
crit 3.8 22.87% 52204.96 10723 112580 196567

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing ${10+$AP*0.437*$m1/100} physical damage and consumes up to $m2 additional rage to deal up to ${$ap*0.874*$m1/100-1} additional damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.311000
  • base_dd_min:10.00
  • base_dd_max:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_strike 2400 8.6% 54.3 8.18sec 19989 0 13529 27880 58599 45.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
54.28 54.28 0.00 0.00 0.0000 0.0000 1084962
Direct Results Count Pct Average Min Max Total Damage
hit 29.8 54.98% 13529.28 8194 28446 403765
crit 24.4 45.02% 27879.86 17048 58599 681197

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • tree:arms
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:30.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:An attack that instantly deals ${8+$ap*60/100} physical damage. A good attack for moments of excess rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:8.00
  • base_dd_max:8.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
melee_main_hand 4967 17.8% 176.7 2.57sec 12709 4977 12818 26398 50264 21.2% 17.3% 24.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.69 176.69 0.00 0.00 2.5537 0.0000 2245576
Direct Results Count Pct Average Min Max Total Damage
hit 66.3 37.52% 12818.33 8639 24400 849857
crit 37.4 21.19% 26397.76 17797 50264 988184
glance 42.4 23.98% 9616.76 6479 18300 407535
miss 30.6 17.31% 0.00 0 0 0

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3087 11.1% 176.0 2.57sec 7928 3093 7993 16455 31415 21.2% 17.3% 23.9% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
176.03 176.03 0.00 0.00 2.5633 0.0000 1395614
Direct Results Count Pct Average Min Max Total Damage
hit 66.0 37.51% 7992.52 5432 15250 527716
crit 37.4 21.25% 16454.65 11123 31415 615384
glance 42.1 23.94% 5992.09 4050 11437 252514
miss 30.5 17.30% 0.00 0 0 0

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:(null)
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 4243 15.2% 58.4 7.72sec 32843 21650 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.40 58.40 0.00 0.00 1.5170 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 58.4 100.00% 0.00 0 0 0

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:20.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 2606 9.3% 58.4 7.72sec 20175 0 15212 31876 59219 29.8% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.40 58.40 0.00 0.00 0.0000 0.0000 1178274
Direct Results Count Pct Average Min Max Total Damage
hit 41.0 70.21% 15212.15 10383 28747 623795
crit 17.4 29.79% 31875.91 21389 59219 554478

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow_oh 1637 5.9% 58.4 7.72sec 12668 0 9560 20009 37012 29.7% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
58.40 58.40 0.00 0.00 0.0000 0.0000 739828
Direct Results Count Pct Average Min Max Total Damage
hit 41.0 70.25% 9559.77 6489 17967 392230
crit 17.4 29.75% 20008.97 13444 37012 347598

Action details: raging_blow_oh

Static Values
  • id:96103
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
recklessness 0 0.0% 2.3 240.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
2.35 2.35 0.00 0.00 0.0000 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
none 2.3 100.00% 0.00 0 0 0

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:rage
  • tree:fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • base_cost:0.0
  • cooldown:240.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:Critical chance of special attacks increased by $s1%. All damage taken increased by $s2%.
  • description:Grants your special attacks an additional $s1% chance to critically hit, but increases all damage taken by $s2%. Lasts $d.
slam 1365 4.9% 32.7 13.47sec 18884 12504 0 0 0 0.0% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.69 32.69 0.00 0.00 1.5103 0.0000 0
Direct Results Count Pct Average Min Max Total Damage
hit 32.7 100.00% 0.00 0 0 0

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • tree:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:15.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $50782m2% weapon damage plus ${$m1*$50782m2/100}.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
slam_mh 1365 4.9% 32.7 13.47sec 18884 0 14452 29772 59043 28.9% 0.0% 0.0% 0.0% 0 0 0 0.0% 0.0% 0.0%

Stats details: slam_mh

executes direct results ticks tick results Execute Time per Execution Tick Time per Tick total dmg
32.69 32.69 0.00 0.00 0.0000 0.0000 617290
Direct Results Count Pct Average Min Max Total Damage
hit 23.2 71.07% 14451.79 10638 28662 335741
crit 9.5 28.93% 29771.50 21798 59043 281549

Action details: slam_mh

Static Values
  • id:50782
  • school:physical
  • resource:rage
  • tree:Unknown
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.05
  • target:Fluffy_Pillow
  • tooltip:(null)
  • description:Slams the opponent, causing $m2% weapon damage plus an additional amount.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:430.96
  • base_dd_max:430.96
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45

Resources

Resource Usage Type Res% DPR RPE
Warrior_Fury_2h_T11_372
bloodthirst rage 46.1% 1368.1 20
colossus_smash rage 7.5% 732.6 20
death_wish rage 0.5% 0.0 7
execute rage 8.1% 1125.0 28
heroic_strike rage 18.3% 1036.1 19
raging_blow rage 19.6% 1711.4 19
Resource Gains Type Count rage Average Overflow
battle_shout rage 12.1 362.2 30.0 0.0%
berserker_rage rage 9.5 75.2 7.9 0.8%
melee_main_hand rage 146.1 3553.2 24.3 1.5%
melee_off_hand rage 145.6 1788.4 12.3 0.5%
Resource Gains Chart

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 0% 100%

Database details

  • id:21156
  • cooldown name:buff_battle_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
battle_trance 19.9 0.0 21.5sec 21.5sec 8% 9%

Database details

  • id:
  • cooldown name:buff_battle_trance
  • tooltip:(null)
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
berserker_rage 9.5 0.0 44.6sec 44.6sec 21% 21%

Database details

  • id:
  • cooldown name:buff_berserker_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
blackwing_dragonkin 3.9 0.0 123.2sec 123.2sec 17% 17%

Database details

  • id:
  • cooldown name:buff_blackwing_dragonkin
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
bloodlust 1.0 0.0 0.0sec 0.2sec 9% 11%

Database details

  • id:
  • cooldown name:buff_bloodlust
  • tooltip:(null)
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
bloodsurge 33.5 6.2 13.2sec 11.1sec 27% 100%

Database details

  • id:
  • cooldown name:buff_bloodsurge
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
colossus_smash 21.9 0.0 21.1sec 21.1sec 29% 27%

Database details

  • id:
  • cooldown name:buff_colossus_smash
  • tooltip:(null)
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
death_wish 3.6 0.0 144.7sec 144.7sec 23% 24%

Database details

  • id:
  • cooldown name:buff_death_wish
  • tooltip:(null)
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
enrage 15.2 30.3 28.1sec 9.1sec 52% 51%

Database details

  • id:14202
  • cooldown name:buff_enrage
  • tooltip:Physical damage increased by $s1%.
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:9.00%
executioner_talent 1.1 15.3 45.0sec 5.5sec 19% 36%

Database details

  • id:90806
  • cooldown name:buff_executioner_talent
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:5
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
flurry 49.3 144.6 9.2sec 2.3sec 78% 76%

Database details

  • id:12968
  • cooldown name:buff_flurry
  • tooltip:Attack speed increased by $s1%.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
golemblood_potion 1.0 0.0 339.5sec 339.5sec 4% 4%

Database details

  • id:
  • cooldown name:buff_golemblood_potion
  • tooltip:(null)
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
heart_of_rage 4.7 0.0 105.8sec 105.8sec 20% 20%

Database details

  • id:
  • cooldown name:buff_heart_of_rage
  • tooltip:(null)
  • max_stacks:1
  • duration:20.00
  • cooldown:100.00
  • default_chance:10.00%
incite 10.1 0.0 41.3sec 41.3sec 10% 17%

Database details

  • id:
  • cooldown name:buff_incite
  • tooltip:(null)
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:66.00%
landslide_mh 14.4 20.6 31.4sec 12.6sec 61% 62%

Database details

  • id:
  • cooldown name:buff_landslide_mh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
landslide_oh 9.4 3.5 46.2sec 32.8sec 29% 32%

Database details

  • id:
  • cooldown name:buff_landslide_oh
  • tooltip:(null)
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
recklessness 2.3 0.0 240.7sec 240.7sec 6% 8%

Database details

  • id:
  • cooldown name:buff_recklessness
  • tooltip:(null)
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
tier11_4pc_melee 1.0 57.4 385.6sec 7.7sec 99% 98%

Database details

  • id:
  • cooldown name:buff_tier11_4pc_melee
  • tooltip:(null)
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
arcane_brilliance

Database details

  • id:
  • cooldown name:buff_arcane_brilliance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
berserker_stance

Database details

  • id:7381
  • cooldown name:buff_berserker_stance
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_kings

Database details

  • id:
  • cooldown name:buff_blessing_of_kings
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might

Database details

  • id:
  • cooldown name:buff_blessing_of_might
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blessing_of_might_regen

Database details

  • id:
  • cooldown name:buff_blessing_of_might_regen
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
fortitude

Database details

  • id:
  • cooldown name:buff_fortitude
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mark_of_the_wild

Database details

  • id:
  • cooldown name:buff_mark_of_the_wild
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%
rage_cap 0.9%

Procs

Count Interval
munched_deep_wounds 34.3 13.5sec
rolled_deep_wounds 31.0 14.8sec

Statistics & Data Analysis

DPS
Population
Convergence 70.95%
σ of the average dps 9.4710
2 * σ / μ 0.0679%
95% Confidence Intervall ( μ ± 2σ ) ( 27898.33 - 27936.21 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 99.93% - 100.07% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 27888.86 - 27945.68 )
Sample Data
σ 947.0963
Minimum 24631.45
Maximum 31816.28
Spread ( max - min ) 7184.83
Range ( max - min ) / 2 3592.42
Range% 12.87
10th Percentile 26693.43
90th Percentile 29139.89
( 90th Percentile - 10th Percentile ) 2446.46
Approx. Iterations needed for
1% dps error 46
0.1% dps error 4603
0.1 scale factor error with delta=300 7973
0.05 scale factor error with delta=300 31893
0.01 scale factor error with delta=300 797325
DPS Timeline Chart

Action Priority List

# action,conditions
0 flask,type=titanic_strength
1 food,type=beer_basted_crocolisk
2 snapshot_stats
3 golemblood_potion,if=!in_combat|buff.bloodlust.react
4 auto_attack
5 stance,choose=berserker
6 recklessness
7 death_wish
8 cleave,if=target.adds>0
9 whirlwind,if=target.adds>0
A heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
B execute,if=buff.executioner_talent.remains<1.5
C colossus_smash
D execute,if=buff.executioner_talent.stack<5
E bloodthirst
F berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
G raging_blow
H slam,if=buff.bloodsurge.react
I execute,if=rage>=50
J battle_shout,if=rage<70

Sample Sequence

0134567JCAEGAEHEGEHAEGEAECAEGEHEFGAEHAEGAEHECAEGEHJAEFGEAHEAGECEHEGEEAHEAFGEHEACEAGEHAEGEHEGEHECEJEGEEFGEEGAECAEEGEJEAG7EHECGEHEAGEHEGEHECAEGAEJAEFGEEGEHECAEHAEHAEHAEFGEJEGCAEAEHEEAHEAGEAECEFGAEH6EGEJEAGEAHEACEAGEEAGEHEAGEHECEJAGEHAEGE7EGECEAGEHEJAEGAEAEGCEAEGEEGEEFGECAJEAGEEGEHAEEAGCAEHAEFGAEJAEGAEAEGCAEAEEAFGEHEAGEHCAEGEHAJEAEFGEHEGCAEHEGE7HEBDDDDJCEGBEIEGEHBEFGEACBAEGEHBEG6HEABEGCEABEGEHBEFGEHBECAEGABEHEGBEJGEICAEGEBEGE

Labels

Label: Number of executes (Average number of executes per iteration)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6519 5223 4782
Agility 729 145 20
Stamina 8265 6613 6440
Intellect 55 53 20
Spirit 82 82 20
Health 158665 135607 0
Mana 120 120 0
Spell Power 0 0 0
Spell Hit 7.87% 7.87% 806
Spell Crit 21.01% 16.01% 2691
Spell Haste 10.39% 5.13% 657
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 14783 10845 190
Melee Hit 9.71% 9.71% 806
Melee Crit 24.00% 16.61% 2691
Melee Haste 5.13% 5.13% 657
Expertise 26.01 26.01 781
Armor 25244 21168 21168
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 5.45% 4.09% 0
Tank-Parry 5.00% 5.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 10.51% 10.51% 1526

Gear

Encoded
head earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
shirt empty
chest earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1 cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2 dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1 fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2 heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
tabard empty

Talents

Arms Rank
War Academy 3
Field Dressing 2
Blitz 0
Tactical Mastery 0
Second Wind 0
Deep Wounds 3
Drums of War 0
Taste for Blood 0
Sweeping Strikes 0
Impale 0
Improved Hamstring 0
Improved Slam 0
Deadly Calm 0
Blood Frenzy 0
Lambs to the Slaughter 0
Juggernaut 0
Sudden Death 0
Wrecking Crew 0
Throwdown 0
Bladestorm 0
Fury Rank
Blood Craze 0
Battle Trance 3
Cruelty 2
Executioner 2
Booming Voice 2
Rude Interruption 2
Piercing Howl 0
Flurry 3
Death Wish 1
Enrage 3
Die by the Sword 0
Raging Blow 1
Rampage 1
Heroic Fury 1
Furious Attacks 0
Meat Cleaver 2
Intensify Rage 2
Bloodsurge 3
Skirmisher 2
Titan's Grip 1
Single-Minded Fury 0
Protection Rank
Incite 2
Toughness 0
Blood and Thunder 0
Shield Specialization 0
Shield Mastery 0
Hold the Line 0
Gag Order 0
Last Stand 0
Concussion Blow 0
Bastion of Defense 0
Warbringer 0
Improved Revenge 0
Devastate 0
Impending Victory 0
Thunderstruck 0
Vigilance 0
Heavy Repercussions 0
Safeguard 0
Sword and Board 0
Shockwave 0

Profile

#!./simc

warrior=Warrior_Fury_2h_T11_372
origin="http://chardev.org/?profile=36611"
level=85
race=worgen
role=attack
use_pre_potion=1
talents=http://www.wowhead.com/talent#warrior-3200030000000000000003222203130111022321020000000000000000000
glyphs=death_wish/cleaving/heroic_throw/bloody_healing/battle/berserker_rage/bloodthirst/raging_blow/slam
actions=flask,type=titanic_strength
actions+=/food,type=beer_basted_crocolisk
actions+=/snapshot_stats
actions+=/golemblood_potion,if=!in_combat|buff.bloodlust.react
actions+=/auto_attack
actions+=/stance,choose=berserker
actions+=/recklessness
actions+=/death_wish
actions+=/cleave,if=target.adds>0
actions+=/whirlwind,if=target.adds>0
actions+=/heroic_strike,if=((rage>85&target.health_pct>=20)|buff.battle_trance.up|((buff.incite.up|buff.colossus_smash.up)&((rage>=50&target.health_pct>=20)|(rage>=75&target.health_pct<20))))
actions+=/execute,if=buff.executioner_talent.remains<1.5
actions+=/colossus_smash
actions+=/execute,if=buff.executioner_talent.stack<5
actions+=/bloodthirst
actions+=/berserker_rage,if=!(buff.death_wish.up|buff.enrage.up|buff.unholy_frenzy.up)&rage>15&cooldown.raging_blow.remains<1
actions+=/raging_blow
actions+=/slam,if=buff.bloodsurge.react
actions+=/execute,if=rage>=50
actions+=/battle_shout,if=rage<70
head=earthen_helmet,heroic=1,type=plate,ilevel=372,quality=epic,stats=2891armor_197exp_257haste_578sta_325str,reforge=exp_crit,gems=reverberating_shadowspirit_20crit_20str_30str,enchant=60str_35mastery
neck=rage_of_ages,heroic=1,ilevel=372,quality=epic,stats=143hit_143mastery_322sta_215str,reforge=hit_crit
shoulders=pauldrons_of_the_great_ettin,heroic=1,type=plate,ilevel=372,quality=epic,stats=2669armor_191crit_171mastery_429sta_266str,gems=20hit_20str_10str,enchant=50str_25crit
chest=earthen_battleplate,heroic=1,type=plate,ilevel=372,quality=epic,stats=3559armor_257crit_217haste_578sta_345str,reforge=haste_exp,gems=40str_20hit_20str_20str,enchant=20all
waist=belt_of_absolute_zero,heroic=1,type=plate,ilevel=372,quality=epic,stats=2002armor_191crit_171hit_429sta_266str,reforge=hit_mastery,gems=40str_40str_10hit
legs=earthen_legplates,heroic=1,type=plate,ilevel=372,quality=epic,stats=3114armor_217hit_257mastery_578sta_345str,reforge=hit_exp,gems=40str_40str,enchant=190ap_55crit
feet=massacre_treads,heroic=1,type=plate,ilevel=372,quality=epic,stats=2447armor_171exp_191mastery_429sta_266str,reforge=mastery_crit,gems=20hit_20str_10str,enchant=35mastery
wrists=bracers_of_the_matredor,heroic=1,type=plate,ilevel=379,quality=epic,stats=1589armor_153crit_113haste_344sta_229str,reforge=haste_mastery,gems=20crit_20str_10str,enchant=50str
hands=earthen_gauntlets,heroic=1,type=plate,ilevel=372,quality=epic,stats=2224armor_191haste_171mastery_429sta_266str,reforge=haste_crit,gems=20hit_20str_10str,enchant=50str
finger1=cloudburst_ring_of_the_earthshaker,heroic=1,ilevel=372,quality=epic,stats=321sta_214str_143hit_143crit,reforge=hit_exp,suffix=120
finger2=dargonaxs_signet,heroic=1,ilevel=379,quality=epic,stats=113crit_153mastery_344sta_229str,gems=20crit_20str_10str
trinket1=fury_of_angerforge,ilevel=359,quality=epic,stats=321crit
trinket2=heart_of_rage,heroic=1,ilevel=372,quality=epic,stats=363exp,reforge=exp_crit,equip=onattackhit_2178str_10%_20dur_100cd
back=glittering_epidermis,heroic=1,ilevel=372,quality=epic,stats=673armor_143crit_143haste_322sta_215str,reforge=haste_mastery,enchant=65crit
main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,ilevel=372,quality=epic,stats=257crit_257hit_578sta_385str,reforge=hit_mastery,enchant=landslide,weapon=sword2h_3.80speed_2138min_3209max
ranged=crossfire_carbine,ilevel=359,quality=epic,stats=72exp_72mastery_161sta_107str,reforge=exp_crit,weapon=gun_3.00speed_1309min_2432max
# Gear Summary # gear_strength=4782
# gear_agility=20
# gear_stamina=6440
# gear_intellect=20
# gear_spirit=20
# gear_attack_power=190
# gear_expertise_rating=781
# gear_hit_rating=806
# gear_crit_rating=2691
# gear_haste_rating=657
# gear_mastery_rating=1526
# gear_armor=21168
# meta_gem=reverberating_shadowspirit
# tier11_2pc_melee=1
# tier11_4pc_melee=1
# trinket1=fury_of_angerforge
# main_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# off_hand=reclaimed_ashkandi_greatsword_of_the_brotherhood,heroic=1,weapon=sword2h_3.80speed_2138min_3209max,enchant=landslide
# ranged=crossfire_carbine,weapon=gun_3.00speed_1309min_2432max

Auras/Buffs

Constant Buff
abominations_might
arcane_tactics
battle_shout
communion
demonic_Pact
devotion_aura
elemental_oath
fel_intelligence
ferocious_inspiration
flametongue_totem
honor_among_thieves
horn_of_winter
hunting_party
improved_icy_talons
leader_of_the_pack
mana_spring_totem
mind_quickening
moonkin
qiraji_fortitude
rampage
roar_of_courage
strength_of_earth
trueshot
unleashed_rage
windfury_totem
wrath_of_air

Fluffy_Pillow : 0dps

Results, Spec and Gear

DPS Error DPR RPS Out RPS In Resource Waiting APM
0.0 0.00 / 0.00% 0.0 868230.8 0.0 health 100.02% 0.0

Charts

http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:t7777776666555544443333332222221111110000000zzzzzzzyyyyyyyyxxxxxxxxwwwwwwwvvvvvvvvvuuuuuuuutttttttttssssssssrrrrrrrrqqqqqqqqppppppppooooooonnnnnnnnmmmmmmmmllllllllkkkkkkkkkjjjjjjjjiiiiiiiiihhhhhhhhgggggggfffffffffeeeeeeeedddddddccccccccbbbbbbbbaaaaaaaaZZZZZZZYYYYYYYYXXXXXXXXXWWWWWWWWVVVVVVVVUUUUUUUUTTTTTTTTTSSSSSSSSRRRRRRRRQQQQQQQPPPPPPPPOOOOOOOONNNNNNNNMMMMMMMMMMMMMLLLLLLLLLLLLLKKKKKKKKKKKKKKJJJJJJJJJJJJJJJIIIIIIIIIIIIIIIIHHHHHHHHHHHHHHGGGGGGGGGGG&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|max=391851281&chtt=Fluffy_Pillow+Health+Timeline&chts=dddddd,18&chco=336600 http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=452|1:|0|avg=0|max=0&chxp=1,1,-nan,100&chtt=Fluffy_Pillow+DPS+Timeline&chts=dddddd,18

Abilities

Resources

Resource Usage Type Res% DPR RPE
Fluffy_Pillow
Resource Gains Type Count health Average Overflow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Constant Buffs
bleeding

Database details

  • id:
  • cooldown name:buff_bleeding
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_bleed

Database details

  • id:
  • cooldown name:buff_blood_frenzy_bleed
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
blood_frenzy_physical

Database details

  • id:
  • cooldown name:buff_blood_frenzy_physical
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
brittle_bones

Database details

  • id:
  • cooldown name:buff_brittle_bones
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
corrosive_spit

Database details

  • id:95466
  • cooldown name:buff_corrosive_spit
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
critical_mass

Database details

  • id:22959
  • cooldown name:buff_critical_mass
  • tooltip:$s1% additional chance to be critically hit by spells.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
curse_of_elements

Database details

  • id:
  • cooldown name:buff_curse_of_elements
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_roar

Database details

  • id:99
  • cooldown name:buff_demoralizing_roar
  • tooltip:Reduces physical damage caused by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
demoralizing_screech

Database details

  • id:24423
  • cooldown name:buff_demoralizing_screech
  • tooltip:Physical damage reduced by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
demoralizing_shout

Database details

  • id:
  • cooldown name:buff_demoralizing_shout
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
earth_and_moon

Database details

  • id:60433
  • cooldown name:buff_earth_and_moon
  • tooltip:Increases spell damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
ebon_plague

Database details

  • id:
  • cooldown name:buff_ebon_plague
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
expose_armor

Database details

  • id:
  • cooldown name:buff_expose_armor
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
faerie_fire

Database details

  • id:91565
  • cooldown name:buff_faerie_fire
  • tooltip:Armor reduced by $s1%. Cannot stealth or turn invisible.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
hemorrhage

Database details

  • id:
  • cooldown name:buff_hemorrhage
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
hunters_mark

Database details

  • id:1130
  • cooldown name:buff_hunters_mark
  • tooltip:All attackers gain $s2 ranged attack power against this target.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
infected_wounds

Database details

  • id:
  • cooldown name:buff_infected_wounds
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
judgements_of_the_just

Database details

  • id:
  • cooldown name:buff_judgements_of_the_just
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
lightning_breath

Database details

  • id:24844
  • cooldown name:buff_lightning_breath
  • tooltip:Increases magic damage taken by $s2%.
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
mangle

Database details

  • id:
  • cooldown name:buff_mangle
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
master_poisoner

Database details

  • id:
  • cooldown name:buff_master_poisoner
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
poisoned

Database details

  • id:
  • cooldown name:buff_poisoned
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
ravage

Database details

  • id:50518
  • cooldown name:buff_ravage
  • tooltip:Increases physical damage taken by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
replenishment

Database details

  • id:57669
  • cooldown name:buff_replenishment
  • tooltip:Replenishes $s1% of maximum mana per 10 sec.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
savage_combat

Database details

  • id:
  • cooldown name:buff_savage_combat
  • tooltip:(null)
  • max_stacks:-1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
scarlet_fever

Database details

  • id:
  • cooldown name:buff_scarlet_fever
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadow_and_flame

Database details

  • id:17800
  • cooldown name:buff_shadow_and_flame
  • tooltip:Chance to be critically hit with spells increased by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
sunder_armor

Database details

  • id:58567
  • cooldown name:buff_sunder_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
tailspin

Database details

  • id:90315
  • cooldown name:buff_tailspin
  • tooltip:Melee and ranged attack speed reduced by $s1%.
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
tear_armor

Database details

  • id:95467
  • cooldown name:buff_tear_armor
  • tooltip:Armor decreased by $s1%.
  • max_stacks:3
  • duration:0.00
  • cooldown:6.00
  • default_chance:101.00%
tendon_rip

Database details

  • id:50271
  • cooldown name:buff_tendon_rip
  • tooltip:All bleed effects cause $s1% additional damage.
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
thunder_clap

Database details

  • id:
  • cooldown name:buff_thunder_clap
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
vindication

Database details

  • id:
  • cooldown name:buff_vindication
  • tooltip:(null)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Uptimes

%

Procs

Count Interval

Statistics & Data Analysis

DPS
Population
Convergence 0.00%
σ of the average dps 0.0000
2 * σ / μ 0.0000%
95% Confidence Intervall ( μ ± 2σ ) ( 0.00 - 0.00 )
Normalized 95% Confidence Intervall ( 1 ± 2σ/μ ) ( 0.00% - 0.00% )
99.7% Confidence Intervall ( μ ± 3σ ) ( 0.00 - 0.00 )
Sample Data
σ 0.0000
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range ( max - min ) / 2 0.00
Range% 0.00
10th Percentile 0.00
90th Percentile 0.00
( 90th Percentile - 10th Percentile ) 0.00
Approx. Iterations needed for
1% dps error 0
0.1% dps error 0
0.1 scale factor error with delta=300 0
0.05 scale factor error with delta=300 0
0.01 scale factor error with delta=300 0
DPS Timeline Chart

Action Priority List

# action,conditions
0 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 469199848 0
Mana 0 0 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% 0.00% 0
Spell Haste 0.00% 0.00% 0
Spell Penetration 0 0 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Expertise 0.00 0.00 0
Armor 10540 11977 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 8.00% 8.00% 0

Gear

Encoded
head empty
neck empty
shoulders empty
shirt empty
chest empty
waist empty
legs empty
feet empty
wrists empty
hands empty
finger1 empty
finger2 empty
trinket1 empty
trinket2 empty
back empty
main_hand empty
off_hand empty
ranged empty
tabard empty

Talents

Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Improved Cower 0
Bloodthirsty 0
Spiked Collar 0
Boar's Speed 0
Culling the Herd 0
Lionhearted 0
Swoop 0
Charge 0
Heart of the Phoenix 0
Spider's Bite 0
Great Resistance 0
Rabid 0
Lick Your Wounds 0
Call of the Wild 0
Shark Attack 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Charge 0
Great Stamina 0
Natural Armor 0
Spiked Collar 0
Boar's Speed 0
Blood of the Rhino 0
Pet Barding 0
Culling the Herd 0
Guard Dog 0
Lionhearted 0
Thunderstomp 0
Grace of the Mantis 0
Great Resistance 0
Last Stand 0
Taunt 0
Roar of Sacrifice 0
Intervene 0
Silverback 0
Wild Hunt 0
Unknown Rank
Serpent Swiftness 0
Dive 0
Dash 0
Great Stamina 0
Natural Armor 0
Boar's Speed 0
Mobility 0
Mobility 0
Owl's Focus 0
Spiked Collar 0
Culling the Herd 0
Lionhearted 0
Carrion Feeder 0
Great Resistance 0
Cornered 0
Feeding Frenzy 0
Wolverine Bite 0
Roar of Recovery 0
Bullheaded 0
Grace of the Mantis 0
Wild Hunt 0
Roar of Sacrifice 0

Profile

#!./simc

enemy=Fluffy_Pillow
origin="unknown"
level=88
race=humanoid
role=tank
use_pre_potion=1
talents=http://www.wowhead.com/talent#enemy-000000000000000000000000000000000000000000000000000000000000000
actions=snapshot_stats
# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per second.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

( 2 * dps_stddev / sqrt( iterations ) ) / dps_avg

Convergence

Rate at which multipling iterations by convergence_scale reduces error

For default convergence_scale=2 it should itself approach 70.71% according to the central limit theorem

G%

Percentage of executes that resulted in glancing blows.

G%

Percentage of executes that resulted in blocking blows.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Max

Maximum crit damage over all iterations.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps_max - dps_min ) / ( 2 * dps_avg )

RPS In

Average resource points generated per second.

RPS Out

Average resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.